Histone H2B type 1-C/E/F/G/I Recombinant Protein | HIST1H2BC recombinant protein

Recombinant Human Histone H2B type 1-C/E/F/G/I

Cat. Num. AAA717192

• Gene Names: HIST1H2BG; H2B/a; H2BFA; H2B.1A; dJ221C16.8
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Histone H2B type 1-C/E/F/G/I; Recombinant Human Histone H2B type 1-C/E/F/G/I; Histone H2B.1 A; Histone H2B.a; H2B/a; Histone H2B.g; H2B/g; Histone H2B.h; H2B/h; Histone H2B.k; H2B/k; Histone H2B.l; HIST1H2BC recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 2-125aa; Full Length
• Sequence: PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
• Sequence Length: 126

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for HIST1H2BC recombinant protein

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.

Product Categories/Family for HIST1H2BC recombinant protein

Epigenetics and Nuclear Signaling

References

Isolation and characterization of two human H1 histone genes within clusters of core histone genes.Albig W., Kardalinou E., Drabent B., Zimmer A., Doenecke D.Genomics 10:940-948(1991) Human histone gene organization nonregular arrangement within a large cluster.Albig W., Kioschis P., Poustka A., Meergans K., Doenecke D.Genomics 40:314-322(1997) The human and mouse replication-dependent histone genes.Marzluff W.F., Gongidi P., Woods K.R., Jin J., Maltais L.J.Genomics 80:487-498(2002) The DNA sequence and analysis of human chromosome 6.Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.Nature 425:805-811(2003) Human spleen histone H2B. Isolation and amino acid sequence.Ohe Y., Hayashi H., Iwai K.J. Biochem. 85:615-624(1979) Endotoxin-neutralizing antimicrobial proteins of the human placenta.Kim H.S., Cho J.H., Park H.W., Yoon H., Kim M.S., Kim S.C.J. Immunol. 168:2356-2364(2002) Biochemical and antibacterial analysis of human wound and blister fluid.Frohm M., Gunne H., Bergman A.-C., Agerberth B., Bergman T., Boman A., Liden S., Joernvall H., Boman H.G.Eur. J. Biochem. 237:86-92(1996) Antimicrobial peptides in the first line defence of human colon mucosa.Tollin M., Bergman P., Svenberg T., Joernvall H., Gudmundsson G.H., Agerberth B.Peptides 24:523-530(2003) Antimicrobial polypeptides of the human colonic epithelium.Howell S.J., Wilk D., Yadav S.P., Bevins C.L.Peptides 24:1763-1770(2003) Quantitative proteomic analysis of post-translational modifications of human histones.Beck H.C., Nielsen E.C., Matthiesen R., Jensen L.H., Sehested M., Finn P., Grauslund M., Hansen A.M., Jensen O.N.Mol. Cell. Proteomics 5:1314-1325(2006) Apoptotic phosphorylation of histone H2B is mediated by mammalian sterile twenty kinase.Cheung W.L., Ajiro K., Samejima K., Kloc M., Cheung P., Mizzen C.A., Beeser A., Etkin L.D., Chernoff J., Earnshaw W.C., Allis C.D.Cell 113:507-517(2003) Monoubiquitination of human histone H2B the factors involved and their roles in HOX gene regulation.Zhu B., Zheng Y., Pham A.-D., Mandal S.S., Erdjument-Bromage H., Tempst P., Reinberg D.Mol. Cell 20:601-611(2005) Inhibition of core histones acetylation by carcinogenic nickel(II) .Golebiowski F., Kasprzak K.S.Mol. Cell. Biochem. 279:133-139(2005) Histone H2B monoubiquitination functions cooperatively with FACT to regulate elongation by RNA polymerase II.Pavri R., Zhu B., Li G., Trojer P., Mandal S., Shilatifard A., Reinberg D.Cell 125:703-717(2006) Gene-specific characterization of human histone H2B by electron capture dissociation.Siuti N., Roth M.J., Mizzen C.A., Kelleher N.L., Pesavento J.J.J. Proteome Res. 5:233-239(2006) The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.Wu L., Zee B.M., Wang Y., Garcia B.A., Dou Y.Mol. Cell 43:132-144(2011) GlcNAcylation of histone H2B facilitates its monoubiquitination.Fujiki R., Hashiba W., Sekine H., Yokoyama A., Chikanishi T., Ito S., Imai Y., Kim J., He H.H., Igarashi K., Kanno J., Ohtake F., Kitagawa H., Roeder R.G., Brown M., Kato S.Nature 480:557-560(2011) Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.Tan M., Luo H., Lee S., Jin F., Yang J.S., Montellier E., Buchou T., Cheng Z., Rousseaux S., Rajagopal N., Lu Z., Ye Z., Zhu Q., Wysocka J., Ye Y., Khochbin S., Ren B., Zhao Y.Cell 146:1016-1028(2011) USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.Zhang Z., Jones A., Joo H.Y., Zhou D., Cao Y., Chen S., Erdjument-Bromage H., Renfrow M., He H., Tempst P., Townes T.M., Giles K.E., Ma L., Wang H.Genes Dev. 27:1581-1595(2013)

NCBI and Uniprot Product Information

• NCBI GI #: 4504257
• NCBI GeneID: 8339
• NCBI Accession #: NP_003509.1
• NCBI GenBank Nucleotide #: NM_003518.3
• UniProt Accession #: P62807; P02278; Q3B872; Q4VB69; Q93078; Q93080
• Molecular Weight: 40.6 kDa
• NCBI Official Full Name: histone H2B type 1-C/E/F/G/I
• NCBI Official Synonym Full Names: histone cluster 1, H2bg
• NCBI Official Symbol: HIST1H2BG
• NCBI Official Synonym Symbols: H2B/a; H2BFA; H2B.1A; dJ221C16.8
• NCBI Protein Information: histone H2B type 1-C/E/F/G/I
• UniProt Protein Name: Histone H2B type 1-C/E/F/G/I
• Protein Family: Histone
• UniProt Gene Name: HIST1H2BC
• UniProt Synonym Gene Names: H2BFL; H2B/a; H2B/g; H2B/h; H2B/k; H2B/l
• UniProt Entry Name: H2B1C_HUMAN

NCBI Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. The protein has antibacterial and antifungal antimicrobial activity. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015]

Uniprot Description

H2B1C: a core component of the nucleoosome. The nucleosome, a basic organizational unit of chromosomal DNA, is octrameric, consisting of two molecules each of histones H2B, H2A, H3, H4. The octamer wraps approximately 147 bp of DNA. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 6p22.1

Cellular Component: cytoplasm; extracellular space; nucleoplasm; nucleosome; nucleus

Molecular Function: DNA binding; protein binding; protein heterodimerization activity

Biological Process: antibacterial humoral response; defense response to Gram-positive bacterium; establishment and/or maintenance of chromatin architecture; innate immune response in mucosa; nucleosome assembly