Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Alpha-1-acid glycoprotein (Orm1) Recombinant Protein | Orm1 recombinant protein

Recombinant Rat Alpha-1-acid glycoprotein (Orm1)

Gene Names
Orm1; AGP; OMD; Orm; Agpa1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-1-acid glycoprotein (Orm1); Recombinant Rat Alpha-1-acid glycoprotein (Orm1); Orosomucoid (OMD); Orm1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
Sequence Positions
19-205aa, Full Length of Mature Protein
Sequence
QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP
Species
Rat
Tag
N-terminal 6xHis-tagged
Function
Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain (By similarity). Appears to function in modulating the activity of the immune system during the acute-phase reaction.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Product Categories/Family for Orm1 recombinant protein
References
"Nucleotide sequence of rat alpha 1-acid glycoprotein messenger RNA."Ricca G.A., Taylor J.M.J. Biol. Chem. 256:11199-11202 (1981)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,575 Da
NCBI Official Full Name
alpha-1-acid glycoprotein
NCBI Official Synonym Full Names
orosomucoid 1
NCBI Official Symbol
Orm1
NCBI Official Synonym Symbols
AGP; OMD; Orm; Agpa1
NCBI Protein Information
alpha-1-acid glycoprotein
UniProt Protein Name
Alpha-1-acid glycoprotein
Protein Family
UniProt Gene Name
Orm1
UniProt Entry Name
A1AG_RAT

NCBI Description

an acute phase reactant protein; may have a role in the acute inflammation response [RGD, Feb 2006]

Research Articles on Orm1

Similar Products

Product Notes

The Orm1 orm1 (Catalog #AAA7137010) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-205aa, Full Length of Mature Protein. The amino acid sequence is listed below: QNPEPANITL GIPITNETLK WLSDKWFYMG AAFRDPVFKQ AVQTIQTEYF YLTPNLINDT IELREFQTTD DQCVYNFTHL GVQRENGTLS KCAGAVKIFA HLIVLKKHGT FMLAFNLTDE NRGLSFYAKK PDLSPELRKI FQQAVKDVGM DESEIVFVDW TKDKCSEQQK QQLELEKETK KETKKDP. It is sometimes possible for the material contained within the vial of "Alpha-1-acid glycoprotein (Orm1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.