Tumor necrosis factor ligand superfamily member 14 (TNFSF14) Active Protein | TNFSF14 active protein

Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14), partial

Cat. Num. AAA7136881

• Gene Names: TNFSF14; LTg; TR2; CD258; HVEML; LIGHT
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor necrosis factor ligand superfamily member 14 (TNFSF14); Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14); partial; Herpes virus entry mediator ligand; HVEM-L; Herpesvirus entry mediator ligand; CD258; HVEML; LIGHT; UNQ391; PRO726; TNFSF14 active protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH7.4; Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 74-240aa, Partial
• Sequence: DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

• Species: Human
• Endotoxin: Less than 1.0EU/ug as determined by LAL method.
• Biological Activity: 1: Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 at 5ug/ml can bind TNFSF14, the EC50 is 45.44-53.29ng/ml.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C.; Store working aliquots at 4 degrees C for up to one week.; Repeated freezing and thawing is not recommended.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Activity

Related Product Information for TNFSF14 active protein

Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM (PubMed:9462508, PubMed:10754304). Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production (PubMed:10754304).

Product Categories/Family for TNFSF14 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 25952144
• NCBI GeneID: 8740
• NCBI Accession #: NP_003798.2
• NCBI GenBank Nucleotide #: NM_003807.3
• UniProt Accession #: O43557; O75476; Q6FHA1; Q8WVF8; Q96LD2; A8K7M2; C9J5H4
• Molecular Weight: 26,350 Da
• NCBI Official Full Name: tumor necrosis factor ligand superfamily member 14 isoform 1
• NCBI Official Synonym Full Names: tumor necrosis factor (ligand) superfamily, member 14
• NCBI Official Symbol: TNFSF14
• NCBI Official Synonym Symbols: LTg; TR2; CD258; HVEML; LIGHT
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 14; delta transmembrane LIGHT; herpesvirus entry mediator A; herpesvirus entry mediator ligand; herpesvirus entry mediator-ligand; herpes virus entry mediator ligand; ligand for herpesvirus entry mediator; t
• UniProt Protein Name: Tumor necrosis factor ligand superfamily member 14
• Protein Family: Tumor necrosis factor ligand superfamily
• UniProt Gene Name: TNFSF14
• UniProt Synonym Gene Names: HVEML; LIGHT; HVEM-L
• UniProt Entry Name: TNF14_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFSF14: Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Activates NFKB, stimulates the proliferation of T-cells, and inhibits growth of the adenocarcinoma HT-29. Acts as a receptor for Herpes simplex virus. Belongs to the tumor necrosis factor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cytokine; Inhibitor

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular space; cytoplasm; plasma membrane; integral to membrane

Molecular Function: protein binding; caspase inhibitor activity; cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: release of cytoplasmic sequestered NF-kappaB; T cell proliferation; T cell activation; apoptosis; T cell costimulation; T cell homeostasis; immune response; negative regulation of caspase activity; signal transduction; positive regulation of myoblast differentiation