Toll-like receptor 4 (TLR4) Recombinant Protein | TLR4 recombinant protein

Recombinant Human Toll-like receptor 4 (TLR4), partial

Cat. Num. AAA7135792

• Gene Names: TLR4; TOLL; CD284; TLR-4; ARMD10
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Toll-like receptor 4 (TLR4); Recombinant Human Toll-like receptor 4 (TLR4); partial; hToll (CD_antigen: CD284); TLR4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized powder; If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, p
• Sequence Positions: 27-631aa; Partial
• Sequence: EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK
• Sequence Length: 799

• Species: Human
• Tag: N-terminal 10xHis-tagged
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. ; Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.; The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for TLR4 recombinant protein

Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide. Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate, and Ni2+. Responses triggered by Ni2+ require non-conserved histidines and are, therefore, species-specific. Both M.tuberculosis HSP70 and HSP65 act via this protein to stimulate NF-kappa-B expression. In complex with TLR6, promotes sterile inflammation in monocytes/macrophages in response to oxidized low-density lipoprotein or amyloid-beta 42. In this context, the initial signal is provided by oxLDL- or amyloid-beta 42-binding to CD36. This event induces the formation of a heterodimer of TLR4 and TLR6, which is rapidly internalized and triggers inflammatory response, leading to the NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion. Binds electronegative LDL (LDL-) and mediates the cytokine release induced by LDL-. Stimulation of monocytes in vitro with M.tuberculosis PstS1 induces p38 MAPK and ERK1/2 activation primarily via TLR2, but also partially via this receptor.

Product Categories/Family for TLR4 recombinant protein

Cardiovascular

References

"Phylogenetic variation and polymorphism at the Toll-like receptor 4 locus (TLR4)."
Smirnova I., Poltorak A., Chan E.K.L., McBride C., Beutler B.Genome Biol. 1:RESEARCH002.1-RESEARCH002.10(2000)

NCBI and Uniprot Product Information

• NCBI GI #: 4507533
• NCBI GeneID: 7099
• NCBI Accession #: NP_003257.1
• NCBI GenBank Nucleotide #: NP_003257.1
• UniProt Accession #: O00206
• Molecular Weight: 72.4kDa
• NCBI Official Full Name: toll-like receptor 4 isoform C
• NCBI Official Synonym Full Names: toll like receptor 4
• NCBI Official Symbol: TLR4
• NCBI Official Synonym Symbols: TOLL; CD284; TLR-4; ARMD10
• NCBI Protein Information: toll-like receptor 4
• UniProt Protein Name: Toll-like receptor 4
• Protein Family: Toll-like receptor
• UniProt Gene Name: TLR4
• UniProt Entry Name: TLR4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]