Peroxisome proliferator-activated receptor delta (Ppard) Recombinant Protein | PPARD recombinant protein

Recombinant Human Peroxisome proliferator-activated receptor delta (Ppard), partial

Cat. Num. AAA7135780

• Gene Names: PPARD; FAAR; NUC1; NUCI; NR1C2; NUCII; PPARB
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Peroxisome proliferator-activated receptor delta (Ppard); Recombinant Human Peroxisome proliferator-activated receptor delta (Ppard); partial; NUCI (Nuclear hormone receptor 1); (NUC1); (Nuclear receptor subfamily 1 group C member 2); (Peroxisome proliferator-activated receptor beta); (PPAR-beta); (NR1C2); (PPARB); (PPAR-delta); PPARD recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized powder; If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, p
• Sequence Positions: 171-441aa; Partial
• Sequence: QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
• Sequence Length: 441

• Species: Human
• Tag: N-terminal 6xHis-tagged
• Expression System: E.coli
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. ; Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.; The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for PPARD recombinant protein

Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand.

Product Categories/Family for PPARD recombinant protein

Cardiovascular

References

"PPAR-delta 5'-complete cDNA fragment."
Aoto T., Ishizuka M., Kazusaka A., Fujita S. Submitted (JAN-2003)

NCBI and Uniprot Product Information

• NCBI GI #: 284807155
• NCBI GeneID: 5467
• NCBI Accession #: NP_001165289.1
• NCBI GenBank Nucleotide #: NP_001165289.1
• UniProt Accession #: Q03181
• Molecular Weight: 35.1kDa
• NCBI Official Full Name: peroxisome proliferator-activated receptor delta isoform 1
• NCBI Official Synonym Full Names: peroxisome proliferator activated receptor delta
• NCBI Official Symbol: PPARD
• NCBI Official Synonym Symbols: FAAR; NUC1; NUCI; NR1C2; NUCII; PPARB
• NCBI Protein Information: peroxisome proliferator-activated receptor delta
• UniProt Protein Name: Peroxisome proliferator-activated receptor delta
• Protein Family: Peroxisome proliferator-activated receptor
• UniProt Gene Name: PPARD
• UniProt Synonym Gene Names: NR1C2; PPARB; PPAR-delta; NUC1; PPAR-beta
• UniProt Entry Name: PPARD_HUMAN

NCBI Description

This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. The encoded protein is thought to function as an integrator of transcriptional repression and nuclear receptor signaling. It may inhibit the ligand-induced transcriptional activity of peroxisome proliferator activated receptors alpha and gamma, though evidence for this effect is inconsistent. Expression of this gene in colorectal cancer cells may be variable but is typically relatively low. Knockout studies in mice suggested a role for this protein in myelination of the corpus callosum, lipid metabolism, differentiation, and epidermal cell proliferation. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms. [provided by RefSeq, Aug 2017]

Uniprot Description

PPAR-delta: Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand. Belongs to the nuclear hormone receptor family. NR1 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 6p21.2

Cellular Component: nucleoplasm; nucleus

Molecular Function: NF-kappaB binding; ligand-dependent nuclear receptor activity; protein binding; DNA binding; zinc ion binding; sequence-specific DNA binding; transcription coactivator activity; steroid hormone receptor activity; drug binding; transcription factor activity; lipid binding

Biological Process: proteoglycan metabolic process; wound healing; negative regulation of smooth muscle cell proliferation; negative regulation of collagen biosynthetic process; heart development; positive regulation of transcription, DNA-dependent; positive regulation of epidermis development; negative regulation of smooth muscle cell migration; glucose transport; negative regulation of transcription from RNA polymerase II promoter; decidualization; positive regulation of vasodilation; vitamin A metabolic process; response to vitamin A; positive regulation of cell proliferation; response to glucose stimulus; axon ensheathment; cell differentiation; negative regulation of epithelial cell proliferation; transcription initiation from RNA polymerase II promoter; cholesterol metabolic process; generation of precursor metabolites and energy; intracellular receptor-mediated signaling pathway; glucose metabolic process; positive regulation of insulin secretion; fatty acid catabolic process; keratinocyte proliferation; keratinocyte migration; cell-substrate adhesion; phospholipid biosynthetic process; regulation of transcription from RNA polymerase II promoter; positive regulation of phosphoinositide 3-kinase cascade; cell proliferation; fatty acid beta-oxidation; negative regulation of inflammatory response; mRNA transcription; positive regulation of fat cell differentiation; steroid hormone mediated signaling; gene expression; lipid metabolic process; negative regulation of cell growth; response to activity; negative regulation of transcription, DNA-dependent; fatty acid transport; embryo implantation; negative regulation of apoptosis