Apolipoprotein C-I (Apoc1) Recombinant Protein | Apoc1 recombinant protein

Recombinant Mouse Apolipoprotein C-I (Apoc1)

Cat. Num. AAA7115346

• Gene Names: Apoc1; apo-CI; apoC-I; Apo-CIB; ApoC-IB
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Apolipoprotein C-I (Apoc1); Recombinant Mouse Apolipoprotein C-I (Apoc1); Apolipoprotein C1; Apoc1 recombinant protein

• Host: In Vitro E Coli Expression System
• Specificity: Adult and fetal liver.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Tris-Based Buffer, 50% Glycerol
• Sequence Positions: 27-88aa; Full Length of Mature Protein
• Sequence: APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
• Sequence Length: 88

• Species: Mouse
• Tag: N-terminal 10xHis-tagged
• Subcellular Location: Secreted
• Protein Families: Apolipoprotein C1 family
• Production Note: Special Offer: The Cell Free host-expressed protein is manufactured from a stock plasmid containing the protein gene. Cell Freehost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Cell Free host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Cell Free host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Apoc1 recombinant protein

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein (By similarity). Binds free fatty acids and reduces their intracellular esterification.

Product Categories/Family for Apoc1 recombinant protein

Cardiovascular

References

"Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications." Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P. Biochim. Biophys. Acta 1764:1363-1371(2006).

NCBI and Uniprot Product Information

• NCBI GI #: 158517825
• NCBI GeneID: 11812
• NCBI Accession #: NP_001103479.1
• NCBI GenBank Nucleotide #: NM_001110009.2
• UniProt Accession #: P34928
• Molecular Weight: 12.5 kDa
• NCBI Official Full Name: apolipoprotein C-I
• NCBI Official Synonym Full Names: apolipoprotein C-I
• NCBI Official Symbol: Apoc1
• NCBI Official Synonym Symbols: apo-CI; apoC-I; Apo-CIB; ApoC-IB
• NCBI Protein Information: apolipoprotein C-I
• UniProt Protein Name: Apolipoprotein C-I
• Protein Family: Apolipoprotein
• UniProt Gene Name: Apoc1
• UniProt Synonym Gene Names: Apoc1b; Apo-CIB; ApoC-IB; Apo-CIB'; ApoC-IB'
• UniProt Entry Name: APOC1_MOUSE

NCBI Description

This gene encodes a precursor plasma protein that is cleaved to yield a signal peptide and two alternatively processed mature peptides. The encoded protein, which is a component of chylomicrons, very low density lipoproteins and high density lipoproteins, transports lipids from the intestines to other locations in the body. This protein binds to free fatty acids preventing their uptake by cells. This protein is a cofactor for lecithin cholesterol acyltransferase, an enzyme that catalyzes the conversion of free cholesterol to cholesteryl esters. The encoded protein inhibits the activity of the cholesteryl ester transfer protein which promotes the exchange of neutral lipids between lipoproteins. In humans this gene is associated with risk of coronary artery disease and age-associated memory impairment. Mice lacking this gene demonstrate impaired memory. This gene is clustered with three other apolipoprotein genes on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

Function: Appears to modulate the interaction of APOE with beta-migrating VLDL and inhibit binding of beta-VLDL to the LDL receptor-related protein. Binds free fatty acids and reduces their intracellular esterification. Ref.4

Subcellular location: Secreted.

Tissue specificity: Secreted in plasma.

Sequence similarities: Belongs to the apolipoprotein C1 family.