X-Ray Repair Cross-Complementing Protein 5 (XRCC5) Recombinant Protein | XRCC5 recombinant protein

Recombinant Human X-Ray Repair Cross-Complementing Protein 5 (XRCC5), Partial

Cat. Num. AAA7115268

• Gene Names: XRCC5; KU80; KUB2; Ku86; NFIV; KARP1; KARP-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: X-Ray Repair Cross-Complementing Protein 5 (XRCC5); Recombinant Human X-Ray Repair Cross-Complementing Protein 5 (XRCC5); Partial; 86KDA subunit of Ku antigen; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80KDA subunit; CTC box-binding factor 85KDA subunit; CTC85; CTCB; FDNA repair protein XR; CC5; Ku80; Ku86; Lupus Ku autoantigen protein p86; Nuclear factor IV; Thyroid-lupus autoantigen; TLAAX-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); XRCC5 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 251-455aa; Partial
• Sequence: LTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVD
• Sequence Length: 732

• Species: Human
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Subcellular Location: Nucleus, Nucleus, Nucleolus, Chromosome
• Protein Families: Ku80 family
• Pathway: Cell Aging And Metabolism
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

Related Product Information for XRCC5 recombinant protein

Single-stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing th together. The assbly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. In association with NAA15, the XRCC5/6 dimer binds to the osteocalcin promoter and activates osteocalcin expression. The XRCC5/6 dimer probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. XRCC5 probably acts as the catalytic subunit of 5'-dRP activity, and allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5/6 dimer together with APEX1 acts as a negative regulator of transcription.

Product Categories/Family for XRCC5 recombinant protein

Epigenetics and Nuclear Signaling

References

Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004).

NCBI and Uniprot Product Information

• NCBI GI #: 10863945
• NCBI GeneID: 7520
• NCBI Accession #: NP_066964.1
• NCBI GenBank Nucleotide #: NM_021141.4
• UniProt Accession #: P13010
• Molecular Weight: 30.4 kDa
• NCBI Official Full Name: X-ray repair cross-complementing protein 5
• NCBI Official Synonym Full Names: X-ray repair cross complementing 5
• NCBI Official Symbol: XRCC5
• NCBI Official Synonym Symbols: KU80; KUB2; Ku86; NFIV; KARP1; KARP-1
• NCBI Protein Information: X-ray repair cross-complementing protein 5
• UniProt Protein Name: X-ray repair cross-complementing protein 5
• UniProt Gene Name: XRCC5
• UniProt Synonym Gene Names: G22P2; CTC85; CTCBF; TLAA
• UniProt Entry Name: XRCC5_HUMAN

NCBI Description

The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. [provided by RefSeq, Jul 2008]

Uniprot Description

Ku80: the 80-kilodalton subunit of the Ku complex, also known as ATP-dependant DNA helicase II. A single stranded DNA-dependent ATP-dependent helicase. It functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by p70.

Protein type: RNA-binding; DNA-binding; EC 3.6.4.-; Nuclear receptor co-regulator; Helicase; Nucleolus; EC 3.6.1.-

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: nucleoplasm; nuclear telomere cap complex; membrane; nuclear chromosome, telomeric region; nucleolus; plasma membrane; nucleus; cytosol

Molecular Function: ATP-dependent DNA helicase activity; protein C-terminus binding; protein binding; DNA binding; ubiquitin protein ligase binding; double-stranded DNA binding; telomeric DNA binding; damaged DNA binding; double-stranded telomeric DNA binding; 5'-deoxyribose-5-phosphate lyase activity; ATP binding

Biological Process: response to drug; cell proliferation; positive regulation of neurogenesis; transcription, DNA-dependent; viral reproduction; double-strand break repair; positive regulation of interferon type I production; innate immune response; brain development; DNA repair; negative regulation of transcription, DNA-dependent; telomere maintenance; double-strand break repair via nonhomologous end joining; DNA duplex unwinding; DNA recombination