Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Vesicle-Associated Membrane Protein-Associated Protein B/C (VAPB) Active Protein | VAPB active protein

Recombinant Human Vesicle-Associated Membrane Protein-Associated Protein B/C (VAPB), Partial

Gene Names
VAPB; ALS8; VAP-B; VAMP-B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vesicle-Associated Membrane Protein-Associated Protein B/C (VAPB); Recombinant Human Vesicle-Associated Membrane Protein-Associated Protein B/C (VAPB); Partial; Vesicle-associated membrane protein-associated protein B/C; VAMP-B/VAMP-C; VAMP-associated protein B/C; VAP-B/VAP-C; VAPB active protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
Ubiquitous. Isoform 1 predominates.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
2-132aa; Partial
Sequence
AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKP
Sequence Length
99
Species
Human
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human EphB2 in functional ELISA is less than 20 ug/ml.
Subcellular Location
Endoplasmic reticulum Membrane, Single-Pass Type IV Membrane Protein
Protein Families
VAMP-Associated Protein (VAP) (TC 9.B.17) Family
Classification
Other Recombinant Protein
Pathway
Cholesterol Metabolism
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for VAPB active protein
Relevance: Vesicle-associated membrane protein-associated protein B/C (VAPB) is presents in mitochondria-associated membranes that are endoplasmic reticulum membrane regions closely apposed to the outer mitochondrial membrane. It can form homodimer, and heterodimer with VAPA. It also interacts with VAMP1, VAMP2, HCV NS5A, NS5B, ZFYVE27 and RMDN3. VAPB participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. It is involved in cellular calcium homeostasis regulation.

Function: Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation.
Product Categories/Family for VAPB active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16 kDa
NCBI Official Full Name
vesicle-associated membrane protein-associated protein B/C isoform 2
NCBI Official Synonym Full Names
VAMP associated protein B and C
NCBI Official Symbol
VAPB
NCBI Official Synonym Symbols
ALS8; VAP-B; VAMP-B
NCBI Protein Information
vesicle-associated membrane protein-associated protein B/C
UniProt Protein Name
Vesicle-associated membrane protein-associated protein B/C
UniProt Gene Name
VAPB
UniProt Synonym Gene Names
VAMP-B/VAMP-C; VAMP-associated protein B/C; VAP-B/VAP-C
UniProt Entry Name
VAPB_HUMAN

NCBI Description

The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. [provided by RefSeq, Jul 2008]

Uniprot Description

VAPB: Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation. Defects in VAPB are the cause of amyotrophic lateral sclerosis type 8 (ALS8). ALS8 is a familial form of amyotrophic lateral sclerosis, a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of cases leading to familial forms. Defects in VAPB are a cause of spinal muscular atrophy proximal adult autosomal dominant (SMAPAD); also called late-onset spinal muscular atrophy Finkel type. A form of spinal muscular atrophy, a neuromuscular disorder characterized by degeneration of the anterior horn cells of the spinal cord, leading to symmetrical muscle weakness and atrophy. SMAPAD is characterized by proximal muscle weakness that begins in the lower limbs and then progresses to upper limbs, onset in late adulthood (after third decade) and a benign course. Most of the patients remain ambulatory 10 to 40 years after clinical onset. Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: protein binding; enzyme binding; protein homodimerization activity; FFAT motif binding; protein heterodimerization activity; microtubule binding; beta-tubulin binding

Biological Process: endoplasmic reticulum organization and biogenesis; cellular calcium ion homeostasis; ER to Golgi vesicle-mediated transport; unfolded protein response, activation of signaling protein activity; sphingolipid metabolic process; positive regulation of viral genome replication; sphingolipid biosynthetic process; unfolded protein response; virus-host interaction; negative regulation of viral protein levels in host cell

Disease: Spinal Muscular Atrophy, Late-onset, Finkel Type; Amyotrophic Lateral Sclerosis 8

Research Articles on VAPB

Similar Products

Product Notes

The VAPB vapb (Catalog #AAA7115146) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-132aa; Partial. The amino acid sequence is listed below: AKVEQVLSLE PQHELKFRGP FTDVVTTNLK LGNPTDRNVC FKVKTTAPRR YCVRPNSGII DAGASINVSV MLQPFDYDPN EKSKHKFMVQ SMFAPTDTSD MEAVWKEAKP EDLMDSKLRC VFELPAENDK P. It is sometimes possible for the material contained within the vial of "Vesicle-Associated Membrane Protein-Associated Protein B/C (VAPB), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.