Tumor Necrosis Factor Receptor Superfamily Member 10B (Tnfrsf10b) Active Protein | Tnfrsf10b active protein
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 10B (Tnfrsf10b), Partial
Gene Names
Tnfrsf10b; MK; DR5; Ly98; KILLER; TRICKB; TRAILR2; TRICK2A; TRICK2B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 10B (Tnfrsf10b); Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 10B (Tnfrsf10b); Partial; Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; MK; CD262; Tnfrsf10b; Dr5; Killer; Tnfrsf10b active protein
Host
Mammalian Cell
Specificity
Highly expressed in heart, lung and kidney.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
53-177aa; Partial
Sequence
NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS
Sequence Length
381
Species
Mouse
Tag
C-terminal FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is less than 1 ug/ml.
Subcellular Location
Membrane, Single-Pass Type I Membrane Protein
Classification
Cytokine
Subdivision
Tumor Necrosis Factor
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Tnfrsf10b active protein
Relevance: Mouse tumor necrosis factor receptor superfamily member 10B (TNFRSF10B) is a member of the TNFR family which contains 1 death domain and 3 TNFR-Cys repeats. TNFRSF10B exhibits high structural and functional homology to TRAIL-R1 (DR-4). TNFRSF10B is highly expressed in heart, lung, lymphocytes, spleen and kidney. In addition, it is regulated by the tumor suppressor p53. TNFRSF10B is the receptor for the cytotoxic ligand TNFSF10/TRAIL. It promotes the activation of NF-kappa-B and is essential for ER stress-induced apoptosis. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases mediating apoptosis.
Function: Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
Function: Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
Product Categories/Family for Tnfrsf10b active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40.9 kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 10B
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 10b
NCBI Official Symbol
Tnfrsf10b
NCBI Official Synonym Symbols
MK; DR5; Ly98; KILLER; TRICKB; TRAILR2; TRICK2A; TRICK2B
NCBI Protein Information
tumor necrosis factor receptor superfamily member 10B
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 10B
Protein Family
UniProt Gene Name
Tnfrsf10b
UniProt Synonym Gene Names
Dr5; Killer
UniProt Entry Name
TR10B_MOUSE
Research Articles on Tnfrsf10b
Similar Products
Product Notes
The Tnfrsf10b tnfrsf10b (Catalog #AAA7115101) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 53-177aa; Partial. The amino acid sequence is listed below: NPAHNRPAGL QRPEESPSRG PCLAGQYLSE GNCKPCREGI DYTSHSNHSL DSCILCTVCK EDKVVETRCN ITTNTVCRCK PGTFEDKDSP EICQSCSNCT DGEEELTSCT PRENRKCVSK TAWAS. It is sometimes possible for the material contained within the vial of "Tumor Necrosis Factor Receptor Superfamily Member 10B (Tnfrsf10b), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
