Interleukin-12 (IL12) Active Protein | IL12 active protein

Recombinant Human Interleukin-12 (IL12)

Cat. Num. AAA7115066

• Gene Names: IL12A; P35; CLMF; NFSK; NKSF1; IL-12A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-12 (IL12); Recombinant Human Interleukin-12 (IL12); Interleukin-12 subunit alpha; IL-12A; Cytotoxic lymphocyte maturation factor 35 kDa subunit; CLMF p35; IL-12 subunit p35; NK cell; IL12A ; NKSF1 stimulatory factor chain 1; IL12 active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
• Sequence Positions: 23-219aa & 23-328aa; Heterodimer
• Sequence: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGD AGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
• Sequence Length: 253

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL) is typically 0.5 ng/ml
• Classification: Cytokine
• Subdivision: Interleukin
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IL12 active protein

IL-12 is a heterodimeric pleiotropic cytokine made up of a 40 kDa (p40) subunit and a 35 kDa (p35) subunit. Human and mouse IL-12 share 70% and 60% amino acid sequence identity in their p40 and p35 subunits, respectively. IL-12 is involved in the differentiation of naive T cells into Th1 cells. It is known as a T cell-stimulating factor, which can stimulate the growth and function of T cells. It stimulates the production of interferon-gamma (IFN-gamma) and tumor necrosis factor-alpha (TNF-alpha) from T cells and natural killer (NK) cells, and reduces IL-4 mediated suppression of IFN-gamma. T cells that produce IL-12 have a coreceptor, CD30, which is associated with IL-12 activity. IL-12 plays an important role in the activities of natural killer cells and T lymphocytes. IL-12 mediates enhancement of the cytotoxic activity of NK cells and CD8+ cytotoxic T lymphocytes.

Product Categories/Family for IL12 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 24430219
• NCBI GeneID: 3592
• NCBI Accession #: NP_000873.2
• NCBI GenBank Nucleotide #: NM_000882.4
• UniProt Accession #: P29459; P29460
• Molecular Weight: 22.5 & 34.7 kDa
• NCBI Official Full Name: interleukin-12 subunit alpha isoform 1
• NCBI Official Synonym Full Names: interleukin 12A
• NCBI Official Symbol: IL12A
• NCBI Official Synonym Symbols: P35; CLMF; NFSK; NKSF1; IL-12A
• NCBI Protein Information: interleukin-12 subunit alpha
• UniProt Protein Name: Interleukin-12 subunit alpha
• UniProt Gene Name: IL12A
• UniProt Synonym Gene Names: NKSF1; IL-12A; CLMF p35; NKSF1
• UniProt Entry Name: IL12A_HUMAN

NCBI Description

This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. [provided by RefSeq, Jul 2008]

Uniprot Description

IL12A: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine- activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC. Belongs to the IL-6 superfamily.

Protein type: Secreted, signal peptide; Secreted; Cytokine

Chromosomal Location of Human Ortholog: 3q25.33

Cellular Component: extracellular space; interleukin-12 complex; cytoplasm

Molecular Function: protein binding; interleukin-27 binding; growth factor activity; interleukin-12 beta subunit binding; protein heterodimerization activity; cytokine activity; interleukin-12 receptor binding

Biological Process: positive regulation of NK T cell activation; cell migration; positive regulation of cell adhesion; positive regulation of T cell mediated cytotoxicity; negative regulation of smooth muscle cell proliferation; positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target; response to virus; positive regulation of tyrosine phosphorylation of Stat4 protein; response to lipopolysaccharide; defense response to protozoan; positive regulation of natural killer cell mediated cytotoxicity; positive regulation of natural killer cell activation; response to UV-B; positive regulation of interferon-gamma production; defense response to Gram-positive bacterium; negative regulation of interleukin-17 production; positive regulation of T cell differentiation; positive regulation of mononuclear cell proliferation; positive regulation of lymphocyte proliferation; positive regulation of T cell proliferation; immune response; cell cycle arrest