Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-4 Receptor Subunit alpha (IL4R) Active Protein | IL4R active protein

Recombinant Human Interleukin-4 Receptor Subunit alpha (IL4R), Partial

Gene Names
IL4R; CD124; IL4RA; IL-4RA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-4 Receptor Subunit alpha (IL4R); Recombinant Human Interleukin-4 Receptor Subunit alpha (IL4R); Partial; Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD124; IL-4-binding protein; IL4-BP; IL4R; IL4RA; IL4R active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Specificity
Isoform 1 and isoform 2 are highly expressed in activated T-cells.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
26-231aa; Extracellular Domain
Sequence
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ
Sequence Length
825
Species
Human
Tag
C-terminal FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells is less than 20 ng/ml.
Subcellular Location
Cell Membrane, Single-Pass Type I Membrane Protein, SUBCELLULAR LOCATION: Isoform 2: Secreted
Protein Families
Type I Cytokine Receptor Family, Type 4 Subfamily
Classification
Cytokine
Subdivision
Interleukin
Pathway
Jak-STAT Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for IL4R active protein
Relevance: Interleukin 4 Receptor alpha (IL4-Ra) is a widely expressed 140 kDa transmembrane glycoprotein in the class I cytokine receptor family. Mature human IL4-Ra consists of a 207 amino acid (aa) extracellular domain (ECD) that contains a cytokine binding region and one fibronectin type III domain, a 24 aa transmembrane segment, and a 569 aa cytoplasmic domain that contains one Box 1 motif and one ITIM motif. IL4-Ra plays an important role in Th2-biased immune responses, alternative macrophage activation, mucosal immunity, allergic inflammation, tumor progression, and atherogenesis. Soluble forms of IL4-Ra, generated by alternate splicing or proteolysis, retain ligand binding properties and inhibit IL-4 bioactivity. IL4-Ra is a component of two distinct receptor complexes and shows species selectivity between human and mouse. It can associate with the common gamma chain (gammac) to form the IL-4 responsive type I receptor in which gammac increases the affinity for IL-4 and enables signaling. It can alternatively associate with IL13-Ra1 to form the type II receptor which is responsive to both IL-4 and IL-13. The use of shared receptor components contributes to the overlapping biological effects of IL-4 and IL-13 as well as other cytokines that utilize gammac.

Function: Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
Product Categories/Family for IL4R active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50.2 kDa
NCBI Official Full Name
interleukin-4 receptor subunit alpha isoform a
NCBI Official Synonym Full Names
interleukin 4 receptor
NCBI Official Symbol
IL4R
NCBI Official Synonym Symbols
CD124; IL4RA; IL-4RA
NCBI Protein Information
interleukin-4 receptor subunit alpha
UniProt Protein Name
Interleukin-4 receptor subunit alpha
Protein Family
UniProt Gene Name
IL4R
UniProt Synonym Gene Names
IL4RA; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; Soluble IL-4 receptor subunit alpha; Soluble IL-4R-alpha; sIL4Ralpha/prot; IL4-BP
UniProt Entry Name
IL4RA_HUMAN

NCBI Description

This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Polymorphisms in this gene are also associated with resistance to human immunodeficiency virus type-1 infection. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012]

Uniprot Description

IL4R: Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. Belongs to the type I cytokine receptor family. Type 4 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 16p12.1-p11.2

Cellular Component: extracellular space; integral to plasma membrane; receptor complex

Molecular Function: protein binding; interleukin-4 receptor activity; receptor signaling protein activity

Biological Process: ovulation; positive regulation of T-helper 2 cell differentiation; negative regulation of T-helper 1 cell differentiation; response to estrogen stimulus; production of molecular mediator of acute inflammatory response; immune response; defense response to protozoan; signal transduction; regulation of cell proliferation; positive regulation of macrophage activation

Disease: Ige Responsiveness, Atopic; Human Immunodeficiency Virus Type 1, Susceptibility To

Research Articles on IL4R

Similar Products

Product Notes

The IL4R il4r (Catalog #AAA7115025) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-231aa; Extracellular Domain. The amino acid sequence is listed below: MKVLQEPTCV SDYMSISTCE WKMNGPTNCS TELRLLYQLV FLLSEAHTCI PENNGGAGCV CHLLMDDVVS ADNYTLDLWA GQQLLWKGSF KPSEHVKPRA PGNLTVHTNV SDTLLLTWSN PYPPDNYLYN HLTYAVNIWS ENDPADFRIY NVTYLEPSLR IAASTLKSGI SYRARVRAWA QCYNTTWSEW SPSTKWHNSY REPFEQ. It is sometimes possible for the material contained within the vial of "Interleukin-4 Receptor Subunit alpha (IL4R), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.