Interferon gamma (IFNG) Active Protein | IFNG active protein

Recombinant Human Interferon gamma (IFNG)

Cat. Num. AAA7115017

• Gene Names: IFNG; IFG; IFI
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interferon gamma (IFNG); Recombinant Human Interferon gamma (IFNG); Interferon Gamma; IFN-Gamma; Immune Interferon; IFNG; IFNG active protein

• Host: E Coli
• Specificity: Released primarily from activated T lymphocytes.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.0
• Sequence Positions: 24-166aa; Full Length of Mature Protein
• Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
• Sequence Length: 166

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by a viral resistance assay using VSV-WISH cells is less than 0.5 ng/ml
• Subcellular Location: Secreted
• Protein Families: Type II (or gamma) Interferon Family
• Classification: Cytokine
• Subdivision: Interferon
• Pathway: HIF-1 Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IFNG active protein

Relevance: IFNgamma is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them, leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNgamma synthesis is induced by IL-2, FGF-basic, and EGF.

Function: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Product Categories/Family for IFNG active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 56786138
• NCBI GeneID: 3458
• NCBI Accession #: NP_000610.2
• NCBI GenBank Nucleotide #: NM_000619.3
• UniProt Accession #: P01579
• Molecular Weight: 16.88 kDa
• NCBI Official Full Name: interferon gamma
• NCBI Official Synonym Full Names: interferon gamma
• NCBI Official Symbol: IFNG
• NCBI Official Synonym Symbols: IFG; IFI
• NCBI Protein Information: interferon gamma
• UniProt Protein Name: Interferon gamma
• Protein Family: Interferon
• UniProt Gene Name: IFNG
• UniProt Synonym Gene Names: IFN-gamma
• UniProt Entry Name: IFNG_HUMAN

NCBI Description

This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]

Uniprot Description

IFNG: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. Homodimer. Released primarily from activated T lymphocytes. Belongs to the type II (or gamma) interferon family.

Protein type: Cytokine; Secreted; Membrane protein, integral; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 12q14

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: interferon-gamma receptor binding; cytokine activity

Biological Process: positive regulation of isotype switching to IgG isotypes; positive regulation of nitric oxide biosynthetic process; positive regulation of osteoclast differentiation; negative regulation of smooth muscle cell proliferation; apoptosis; positive regulation of interleukin-23 production; positive regulation of interleukin-12 production; positive regulation of interleukin-6 biosynthetic process; negative regulation of epithelial cell differentiation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of killing of cells of another organism; sensory perception of mechanical stimulus; positive regulation of interleukin-1 beta secretion; positive regulation of membrane protein ectodomain proteolysis; cell surface receptor linked signal transduction; positive regulation of MHC class II biosynthetic process; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; positive regulation of T cell proliferation; cell cycle arrest; defense response to virus; regulation of the force of heart contraction; positive regulation of peptidyl-serine phosphorylation of STAT protein; response to drug; neutrophil chemotaxis; positive regulation of synaptic transmission, cholinergic; adaptive immune response; negative regulation of myelination; CD8-positive, alpha-beta T cell differentiation during immune response; unfolded protein response; response to virus; cytokine and chemokine mediated signaling pathway; positive regulation of tumor necrosis factor production; defense response to protozoan; humoral immune response; antigen processing and presentation; positive regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of chemokine biosynthetic process; positive regulation of interleukin-12 biosynthetic process; negative regulation of interleukin-17 production; protein import into nucleus, translocation; defense response to bacterium; neutrophil apoptosis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of neuron differentiation; cell motility; regulation of insulin secretion

Disease: Hepatitis C Virus, Susceptibility To; Aplastic Anemia; Mycobacterium Tuberculosis, Susceptibility To; Tuberous Sclerosis 2; Human Immunodeficiency Virus Type 1, Susceptibility To