Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transforming Growth Factor beta-1 (Tgfb1) Active Protein | Tgfb1 active protein

Recombinant Mouse Transforming Growth Factor beta-1 (Tgfb1)

Gene Names
Tgfb1; Tgfb; Tgfb-1; TGFbeta1; TGF-beta1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transforming Growth Factor beta-1 (Tgfb1); Recombinant Mouse Transforming Growth Factor beta-1 (Tgfb1); TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP; latency-associated peptide; TGFbeta; TGF-beta 1 protein; transforming growth factor beta-1; Tgfb1 active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 4 mM HCl
Sequence Positions
279-390aa; Full Length of Mature Protein
Sequence
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Sequence Length
390
Species
Mouse
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells is less than 1 ng/ml.
Subcellular Location
Secreted, Extracellular Space, Extracellular Matrix
Protein Families
TGF-beta Family
Classification
Cytokine
Subdivision
Growth Factor
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Tgfb1 active protein
Relevance: Transforming growth factor beta 1 (TGFbeta1) is the prototype of a growing superfamily of peptide growth factors and plays a prominent role in a variety of cellular processes, including cell-cycle progression, cell differentiation, reproductive function, development, motility, adhesion, neuronal growth, bone morphogenesis, wound healing, and immune surveillance. TGF-beta1, TGF-beta2 and TGF-beta3 signal via the same heteromeric receptor complex, consisting of a ligand binding TGF-beta receptor type II (TbetaR-II), and a TGF-beta receptor type I (TbetaR-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF-beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.

Function: Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
Product Categories/Family for Tgfb1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
12.8 kDa
NCBI Official Full Name
Transforming growth factor beta-1 proprotein
NCBI Official Synonym Full Names
transforming growth factor, beta 1
NCBI Official Symbol
Tgfb1
NCBI Official Synonym Symbols
Tgfb; Tgfb-1; TGFbeta1; TGF-beta1
NCBI Protein Information
transforming growth factor beta-1 proprotein
UniProt Protein Name
Transforming growth factor beta-1
UniProt Gene Name
Tgfb1
UniProt Synonym Gene Names
TGF-beta-1; LAP
UniProt Entry Name
TGFB1_MOUSE

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. Mice lacking a functional copy of this gene develop severe multifocal inflammatory disease, yolk sac defects and colon cancer. [provided by RefSeq, Aug 2016]

Uniprot Description

TGFB1: Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. Homodimer; disulfide-linked, or heterodimer with TGFB2. Secreted and stored as a biologically inactive form in the extracellular matrix in a 290 kDa complex (large latent TGF-beta1 complex) containing the TGFB1 homodimer, the latency-associated peptide (LAP), and the latent TGFB1 binding protein-1 (LTBP1). The complex without LTBP1 is known as the'small latent TGF-beta1 complex'. Dissociation of the TGFB1 from LAP is required for growth factor activation and biological activity. Release of the large latent TGF-beta1 complex from the extracellular matrix is carried out by the matrix metalloproteinase MMP3. May interact with THSD4; this interaction may lead to sequestration by FBN1 microfibril assembly and attenuation of TGFB signaling. Interacts with the serine proteases, HTRA1 and HTRA3: the interaction with either inhibits TGFB1-mediated signaling. The HTRA protease activity is required for this inhibition. Interacts with CD109, DPT and ASPN. Activated in vitro at pH below 3.5 and over 12.5. Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Co-localizes with ASPN in chondrocytes within OA lesions of articular cartilage. Belongs to the TGF-beta family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Cellular Component: proteinaceous extracellular matrix; extracellular space; cell surface; microvillus; cell soma; axon; cell; cytoplasm; extracellular region; nucleus; secretory granule

Molecular Function: protein binding; protein homodimerization activity; enzyme binding; growth factor activity; protein heterodimerization activity; punt binding; cytokine activity; protein N-terminus binding; glycoprotein binding; transforming growth factor beta receptor binding; antigen binding

Biological Process: positive regulation of apoptosis; positive regulation of transcription, DNA-dependent; SMAD protein nuclear translocation; positive regulation of protein amino acid dephosphorylation; activation of NF-kappaB transcription factor; regulation of protein import into nucleus; positive regulation of MAP kinase activity; regulation of transforming growth factor beta receptor signaling pathway; negative regulation of ossification; cell cycle arrest; positive regulation of isotype switching to IgA isotypes; regulatory T cell differentiation; T cell differentiation; positive regulation of interleukin-17 production; regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation; positive regulation of chemotaxis; positive regulation of smooth muscle cell differentiation; positive regulation of blood vessel endothelial cell migration; negative regulation of immune response; regulation of sodium ion transport; negative regulation of fat cell differentiation; negative regulation of blood vessel endothelial cell migration; lymph node development; positive regulation of protein secretion; regulation of MAPKKK cascade; positive regulation of cell division; positive regulation of transcription from RNA polymerase II promoter; response to progesterone stimulus; endoderm development; myelination; positive regulation of odontogenesis; negative regulation of phagocytosis; evasion of host defenses by virus; T cell activation; wound healing; positive regulation of cellular protein metabolic process; myeloid dendritic cell differentiation; negative regulation of transcription from RNA polymerase II promoter; phosphate metabolic process; response to organic substance; negative regulation of cell proliferation; CD4-positive, CD25-positive, alpha-beta regulatory T cell lineage commitment; negative regulation of T cell proliferation; mammary gland development; regulation of DNA binding; negative regulation of release of sequestered calcium ion into cytosol; positive regulation of cell proliferation; protein kinase B signaling cascade; protein export from nucleus; inflammatory response; positive regulation of exit from mitosis; epidermal growth factor receptor signaling pathway; mitotic cell cycle checkpoint; common-partner SMAD protein phosphorylation; positive regulation of phosphoinositide 3-kinase activity; positive regulation of peptidyl-serine phosphorylation; SMAD protein complex assembly; regulation of cell proliferation; cell proliferation; positive regulation of protein kinase B signaling cascade; positive regulation of protein complex assembly; negative regulation of interleukin-17 production; positive regulation of protein import into nucleus; epithelial to mesenchymal transition; negative regulation of cell growth; negative regulation of cell-cell adhesion; negative regulation of skeletal muscle development; mononuclear cell proliferation; protein amino acid phosphorylation; hyaluronan catabolic process; regulation of apoptosis; negative regulation of neuroblast proliferation; receptor catabolic process; transforming growth factor beta receptor signaling pathway; positive regulation of superoxide release; germ cell migration; chondrocyte differentiation; negative regulation of mitotic cell cycle; T cell homeostasis; defense response to fungus, incompatible interaction; cell growth; tolerance induction to self antigen; regulation of striated muscle development; skeletal muscle development; organ regeneration; cell activation; organ morphogenesis; negative regulation of DNA replication; hemopoietic progenitor cell differentiation; negative regulation of transcription, DNA-dependent; positive regulation of epithelial cell proliferation; positive regulation of collagen biosynthetic process; defense response; response to estradiol stimulus; negative regulation of cell cycle; regulation of interleukin-23 production; positive regulation of histone deacetylation; negative regulation of protein amino acid phosphorylation; lipopolysaccharide-mediated signaling pathway; adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains; skeletal development; negative regulation of epithelial cell proliferation; intercellular junction assembly and maintenance; regulation of binding; MAPKKK cascade; morphogenesis of a branching structure; cellular calcium ion homeostasis; protein import into nucleus, translocation; ATP biosynthetic process; positive regulation of histone acetylation; positive regulation of protein amino acid phosphorylation; negative regulation of myoblast differentiation; negative regulation of T cell activation; growth; positive regulation of cell migration

Research Articles on Tgfb1

Similar Products

Product Notes

The Tgfb1 tgfb1 (Catalog #AAA7115008) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 279-390aa; Full Length of Mature Protein. The amino acid sequence is listed below: ALDTNYCFSS TEKNCCVRQL YIDFRKDLGW KWIHEPKGYH ANFCLGPCPY IWSLDTQYSK VLALYNQHNP GASASPCCVP QALEPLPIVY YVGRKPKVEQ LSNMIVRSCK CS. It is sometimes possible for the material contained within the vial of "Transforming Growth Factor beta-1 (Tgfb1), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.