Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A) Recombinant Protein | FCGR2A recombinant protein

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial

Gene Names
FCGR2A; CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A); Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A); partial; FCGR2A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
34-217aa; Partial
Sequence
QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,930 Da
NCBI Official Full Name
low affinity immunoglobulin gamma Fc region receptor II-a isoform 1
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIa
NCBI Official Symbol
FCGR2A
NCBI Official Synonym Symbols
CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor II-a
UniProt Protein Name
Low affinity immunoglobulin gamma Fc region receptor II-a
UniProt Gene Name
FCGR2A
UniProt Synonym Gene Names
CD32; FCG2; FCGR2A1; IGFR2; IgG Fc receptor II-a; Fc-gamma-RIIa; FcRII-a

NCBI Description

This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2008]

Uniprot Description

Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.

Research Articles on FCGR2A

Similar Products

Product Notes

The FCGR2A fcgr2a (Catalog #AAA7111619) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-217aa; Partial. The amino acid sequence is listed below: QAAAPPKAVL KLEPPWINVL QEDSVTLTCQ GARSPESDSI QWFHNGNLIP THTQPSYRFK ANNNDSGEYT CQTGQTSLSD PVHLTVLSEW LVLQTPHLEF QEGETIMLRC HSWKDKPLVK VTFFQNGKSQ KFSHLDPTFS IPQANHSHSG DYHCTGNIGY TLFSSKPVTI TVQVPSMGSS SPMG . It is sometimes possible for the material contained within the vial of "Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.