Burkholderia thailandensis Type III secretion apparatus needle Recombinant Protein | yscF recombinant protein
Recombinant Burkholderia thailandensis Type III secretion apparatus needle protein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Burkholderia thailandensis Type III secretion apparatus needle; Recombinant Burkholderia thailandensis Type III secretion apparatus needle protein; yscF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-89aa
Sequence
MSNPPTPLLTDYEWSGYLTGIGRAFDTGVKDLNQQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR
Sequence Length
Full Length
Organism
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Tag Information
N-terminal 6xHis-tagged
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
References
"Bacterial genome adaptation to niches: divergence of the potential virulence genes in three Burkholderia species of different survival strategies." Kim H.S., Schell M.A., Yu Y., Ulrich R.L., Sarria S.H., Nierman W.C., DeShazer D.BMC Genomics 6:174-174 (2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.9 kDa
NCBI Official Full Name
EscF/YscF/HrpA family type III secretion system needle major subunit
UniProt Protein Name
Type III secretion apparatus needle protein
Protein Family
UniProt Gene Name
yscF
Similar Products
Product Notes
The yscF yscf (Catalog #AAA7111014) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-89aa with tag N-terminal 6xHis-tagged. The amino acid sequence is listed below: MSNPPTPLLT DYEWSGYLTG IGRAFDTGVK DLNQQLQDAQ ANLTKNPSDP TALANYQMIM SEYNLYRNAQ SSAVKSMKDI DSSIVSNFR. It is sometimes possible for the material contained within the vial of "Burkholderia thailandensis Type III secretion apparatus needle, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
