G-protein coupled bile acid receptor 1 (GPBAR1) Recombinant Protein | GPBAR1 recombinant protein

Recombinant Human G-protein coupled bile acid receptor 1 (GPBAR1), partial

Cat. Num. AAA7093916

• Gene Names: GPBAR1; BG37; TGR5; M-BAR; GPCR19; GPR131
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: G-protein coupled bile acid receptor 1 (GPBAR1); Recombinant Human G-protein coupled bile acid receptor 1 (GPBAR1); partial; GPBAR1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 283-330aa; Partial
• Sequence: GDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 116284384
• NCBI GeneID: 151306
• NCBI Accession #: NP_001070659.1
• NCBI GenBank Nucleotide #: NM_001077191.1
• UniProt Accession #: Q8TDU6; B3KV35
• Molecular Weight: 35,248 Da
• NCBI Official Full Name: G-protein coupled bile acid receptor 1
• NCBI Official Synonym Full Names: G protein-coupled bile acid receptor 1
• NCBI Official Symbol: GPBAR1
• NCBI Official Synonym Symbols: BG37; TGR5; M-BAR; GPCR19; GPR131
• NCBI Protein Information: G-protein coupled bile acid receptor 1
• UniProt Protein Name: G-protein coupled bile acid receptor 1
• Protein Family: G-protein coupled bile acid receptor
• UniProt Gene Name: GPBAR1
• UniProt Synonym Gene Names: TGR5; hGPCR19; M-BAR; BG37

NCBI Description

This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activation of a MAP kinase signaling pathway, and internalization of the receptor. The receptor is implicated in the suppression of macrophage functions and regulation of energy homeostasis by bile acids. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids.