E3 ubiquitin-protein ligase ZNRF2 (znrf2) Recombinant Protein | znrf2b recombinant protein
Recombinant Danio rerio E3 ubiquitin-protein ligase ZNRF2 (znrf2)
Gene Names
znrf2b; znrf2; zgc:152865
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase ZNRF2 (znrf2); Recombinant Danio rerio E3 ubiquitin-protein ligase ZNRF2 (znrf2); E3 ubiquitin-protein ligase ZNRF2; EC= 6.3.2.-; Zinc/RING finger protein 2; znrf2b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-217aa; full length protein
Sequence
GAKQSSPAANGRTRAYSGSDLPSATASVNGRTAAVLRYNNSQGASGATSAASASSSAAVA SQFISSRTRSVGPSARPQSGINIPNSGAYSSADSGNSTPEEPGGERERSTGAPRLVIGSL PAHLSPHLFGGFKCPVCSKFISSDEMDLHLVMCLTKPRVTYNEDVLSKDAGECAICLEEL LQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHPAD
Sequence Length
217
Species
Zebrafish
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,638 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase znrf2
NCBI Official Synonym Full Names
zinc and ring finger 2b
NCBI Official Symbol
znrf2b
NCBI Official Synonym Symbols
znrf2; zgc:152865
NCBI Protein Information
E3 ubiquitin-protein ligase znrf2
UniProt Protein Name
E3 ubiquitin-protein ligase znrf2
UniProt Gene Name
znrf2
Uniprot Description
May play a role in the establishment and maintenance of neuronal transmission and plasticity via its ubiquitin ligase activity. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Similar Products
Product Notes
The znrf2b znrf2 (Catalog #AAA7071658) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-217aa; full length protein. The amino acid sequence is listed below: GAKQSSPAAN GRTRAYSGSD LPSATASVNG RTAAVLRYNN SQGASGATSA ASASSSAAVA SQFISSRTRS VGPSARPQSG INIPNSGAYS SADSGNSTPE EPGGERERST GAPRLVIGSL PAHLSPHLFG GFKCPVCSKF ISSDEMDLHL VMCLTKPRVT YNEDVLSKDA GECAICLEEL LQGDTIARLP CLCIYHKGCI DEWFEVNRSC PEHPAD. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase ZNRF2 (znrf2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
