G-protein coupled receptor homolog US28 (US28) Recombinant Protein | US28 recombinant protein

Recombinant Human cytomegalovirus G-protein coupled receptor homolog US28 (US28), partial

Cat. Num. AAA7058426

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: G-protein coupled receptor homolog US28 (US28); Recombinant Human cytomegalovirus G-protein coupled receptor homolog US28 (US28); partial; US28 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 295-354. Partial
• Sequence: GTKFRQELHCLLAEFRQRLFSRDVSWYHSMSFSRRSSPSRRETSSDTLSDEVCRVSQIIP
• Sequence Length: 354

• Species: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 59800434
• UniProt Accession #: P69332; P09704; P32952; Q7M6H3
• Molecular Weight: 41,064 Da
• NCBI Official Full Name: G-protein coupled receptor homolog US28
• UniProt Protein Name: G-protein coupled receptor homolog US28
• Protein Family: G-protein coupled receptor
• UniProt Gene Name: US28

Uniprot Description

Receptor for a C-C type chemokine. Binds to a number of different CC-chemokines including CCL5/RANTES, CCL2/MCP-1, CCL3/MIP-1-alpha as well as CX3CL1/Fractalkine. Transduces signals resulting in the activation of MAP kinase signaling pathways and augmentation of intracellular calcium ion levels, leading to alterations in chemotactic behavior of vascular smooth muscle cells and macrophages. The US28 receptor also exhibits high levels of agonist-independent signaling activity and agonist-independent endocytosis. Interacts with endogenous Gaq/11 subunits and thereby constitutively activates phospholipase C.