Mitochondrial import receptor subunit TOM70 Recombinant Protein | TOM70 recombinant protein
Mitochondrial import receptor subunit TOM70
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial import receptor subunit TOM70; TOM70 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-617aa; full length protein
Sequence
MKSFITRNKTAILATVAATGTAIGAYYYYNQLQQQQQRGKKNTINKDEKKDTKDSQKETEGAKKSTAPSNPPIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLREQGLM
Sequence Length
Full Length Protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for TOM70 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for TOM70 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
70,123 Da
NCBI Official Full Name
Mitochondrial import receptor subunit TOM70
UniProt Protein Name
Mitochondrial import receptor subunit TOM70
Protein Family
UniProt Gene Name
TOM70
UniProt Synonym Gene Names
MAS70; OMP1
UniProt Entry Name
TOM70_YEAS7
Uniprot Description
Component of the TOM (translocase of outer membrane) receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM20 and TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore ().
Similar Products
Product Notes
The TOM70 tom70 (Catalog #AAA7043512) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-617aa; full length protein. The amino acid sequence is listed below: MKSFITRNKT AILATVAATG TAIGAYYYYN QLQQQQQRGK KNTINKDEKK DTKDSQKETE GAKKSTAPSN PPIYPVSSNG EPDFSNKANF TAEEKDKYAL ALKDKGNQFF RNKKYDDAIK YYNWALELKE DPVFYSNLSA CYVSVGDLKK VVEMSTKALE LKPDYSKVLL RRASANEGLG KFADAMFDLS VLSLNGDFND ASIEPMLERN LNKQAMSKLK EKFGDIDTAT ATPTELSTQP AKERKDKQEN LPSVTSMASF FGIFKPELTF ANYDESNEAD KELMNGLSNL YKRSPESYDK ADESFTKAAR LFEEQLDKNN EDEKLKEKLA ISLEHTGIFK FLKNDPLGAH EDIKKAIELF PRVNSYIYMA LIMADRNDST EYYNYFDKAL KLDSNNSSVY YHRGQMNFIL QNYDQAGKDF DKAKELDPEN IFPYIQLACL AYRENKFDDC ETLFSEAKRK FPEAPEVPNF FAEILTDKND FDKALKQYDL AIELENKLDG IYVGIAPLVG KATLLTRNPT VENFIEATNL LEKASKLDPR SEQAKIGLAQ MKLQQEDIDE AITLFEESAD LARTMEEKLQ AITFAEAAKV QQRIRSDPVL AKKIQETLAK LREQGLM. It is sometimes possible for the material contained within the vial of "Mitochondrial import receptor subunit TOM70, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
