Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Synaptotagmin-3 Recombinant Protein | Syt3 recombinant protein

Synaptotagmin-3

Gene Names
Syt3; SIII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Synaptotagmin-3; Syt3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-588aa; full length protein
Sequence
MSGDYEDDLCRRALILVSDLCARIRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHAHPAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRTGGGSGEAGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGLLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE
Sequence Length
Full Length Protein
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Syt3 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Syt3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,313 Da
NCBI Official Full Name
synaptotagmin-3
NCBI Official Synonym Full Names
synaptotagmin 3
NCBI Official Symbol
Syt3
NCBI Official Synonym Symbols
SIII
NCBI Protein Information
synaptotagmin-3
UniProt Protein Name
Synaptotagmin-3
Protein Family
UniProt Gene Name
Syt3
UniProt Synonym Gene Names
SytIII
UniProt Entry Name
SYT3_RAT

NCBI Description

member of the synaptotagmin family; brain specific calcium/phospholipid-binding protein; essential for calcium-dependent synaptic vesicle exocytosis; may be the calcium sensor for fast calcium-triggered neurotransmitter release [RGD, Feb 2006]

Uniprot Description

Ca2+ sensor involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain. Ca2+ induces binding of the C2-domains to phospholipid membranes and to assembled SNARE-complexes; both actions contribute to triggering exocytosis (PubMed:11823420, PubMed:18508778). Plays a role in dendrite formation by melanocytes ().

Similar Products

Product Notes

The Syt3 syt3 (Catalog #AAA7043418) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-588aa; full length protein. The amino acid sequence is listed below: MSGDYEDDLC RRALILVSDL CARIRDADTN DRCQEFNELR IRGYPRGPDA DISVSLLSVI VTFCGIVLLG VSLFVSWKLC WVPWRDKGGS AVGGGPLRKD LAPGVGLAGL VGGGGHHLGA SLGGHPLLGG PHHHAHPAHH PPFAELLEPG GLGGSEPPEP SYLDMDSYPE AAVASVVAAG VKPSQTSPEL PSEGGTGSGL LLLPPSGGGL PSAQSHQQVT SLAPTTRYPA LPRPLTQQTL TTQADPSSEE RPPALPLPLP GGEEKAKLIG QIKPELYQGT GPGGRRTGGG SGEAGAPCGR ISFALRYLYG SDQLVVRILQ ALDLPAKDSN GFSDPYVKIY LLPDRKKKFQ TKVHRKTLNP IFNETFQFSV PLAELAQRKL HFSVYDFDRF SRHDLIGQVV LDNLLELAEQ PPDRPLWRDI LEGGSEKADL GELNFSLCYL PTAGLLTVTI IKASNLKAMD LTGFSDPYVK ASLISEGRRL KKRKTSIKKN TLNPTYNEAL VFDVAPESVE NVGLSIAVVD YDCIGHNEVI GVCRVGPEAA DPHGREHWAE MLANPRKPVE HWHQLVEEKT LSSFTKGGKG LSEKENSE. It is sometimes possible for the material contained within the vial of "Synaptotagmin-3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.