Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NADPH--cytochrome P450 reductase Recombinant Protein | ccr1 recombinant protein

NADPH--cytochrome P450 reductase

Gene Names
ccr1; SPBC365.17
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NADPH--cytochrome P450 reductase; ccr1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-678aa; full length protein
Sequence
MKTYEYVLLVIILILSLCYFIYNNFLNKPKAPERRVVATDSIVELMEAEKLTAAVFFGSQTGTAEDFAYRFSTEAKANFNLTNMVFDLENYDLTDLDNFDRSKLLVFFLATYGEGEPTDNAEAFLQLLEGDDTVFSSGKGIEDTPFEGIRYAIFGLGNHTYEYYNAMAKKVDAAMTRLGATRVGNLGLGDDAAGMLEEDYLQWKDDTLPEIGKLFHLQEVHKEYNPMFEVIEKPEISNTSSTVFLGEPSRQQLKGNVASKAPRSQANPFFSSPVRSLELFKSGSRNCLHLELDIADSGMRYQTGDYASICPMNPSQAVDDLLEVLGLKEKRDTVIIVKPIDTLDKAPVLSPTTYDTVFRYYYEICGIVSRQLLSFIAPFAPTPESKQELEKLGNDYDYFKKNVVDLHLNLAQVLRRVSPDAPFTKLPFSMLLENMAHMKPRYYSISSSSVVHPDKVHVTAVVDKKEWTDKNHIFYGLTTNYLLAHCRHMHGEKIPHPNGLEYTLEGPRKNWTGKIPMFVKKSTFRLAPPDVPIIMVGPGTGVAPFRGFVMERANLASKGVKVAKTLLFYGCQYSDKDFLYKEEWQQYKDVLKDSFELITAFSREQDHKIYVQHRLLEHSDTIAKLVEEGAAFYICGDADHMAKDVVNALASILTTVDVDGMKAVKALRDDNRFFEDTW
Sequence Length
Full Length Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ccr1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for ccr1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76,775 Da
NCBI Official Full Name
NADPH-cytochrome p450 reductase
NCBI Official Symbol
ccr1
NCBI Official Synonym Symbols
SPBC365.17
NCBI Protein Information
NADPH-cytochrome p450 reductase
UniProt Protein Name
NADPH--cytochrome P450 reductase
UniProt Gene Name
ccr1
UniProt Synonym Gene Names
CPR; P450R
UniProt Entry Name
NCPR_SCHPO

Uniprot Description

This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5. Involved in ergosterol biosynthesis.

Similar Products

Product Notes

The ccr1 ccr1 (Catalog #AAA7043212) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-678aa; full length protein. The amino acid sequence is listed below: MKTYEYVLLV IILILSLCYF IYNNFLNKPK APERRVVATD SIVELMEAEK LTAAVFFGSQ TGTAEDFAYR FSTEAKANFN LTNMVFDLEN YDLTDLDNFD RSKLLVFFLA TYGEGEPTDN AEAFLQLLEG DDTVFSSGKG IEDTPFEGIR YAIFGLGNHT YEYYNAMAKK VDAAMTRLGA TRVGNLGLGD DAAGMLEEDY LQWKDDTLPE IGKLFHLQEV HKEYNPMFEV IEKPEISNTS STVFLGEPSR QQLKGNVASK APRSQANPFF SSPVRSLELF KSGSRNCLHL ELDIADSGMR YQTGDYASIC PMNPSQAVDD LLEVLGLKEK RDTVIIVKPI DTLDKAPVLS PTTYDTVFRY YYEICGIVSR QLLSFIAPFA PTPESKQELE KLGNDYDYFK KNVVDLHLNL AQVLRRVSPD APFTKLPFSM LLENMAHMKP RYYSISSSSV VHPDKVHVTA VVDKKEWTDK NHIFYGLTTN YLLAHCRHMH GEKIPHPNGL EYTLEGPRKN WTGKIPMFVK KSTFRLAPPD VPIIMVGPGT GVAPFRGFVM ERANLASKGV KVAKTLLFYG CQYSDKDFLY KEEWQQYKDV LKDSFELITA FSREQDHKIY VQHRLLEHSD TIAKLVEEGA AFYICGDADH MAKDVVNALA SILTTVDVDG MKAVKALRDD NRFFEDTW. It is sometimes possible for the material contained within the vial of "NADPH--cytochrome P450 reductase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.