Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Golgi SNAP receptor complex member 2 Recombinant Protein | Gosr2 recombinant protein

Golgi SNAP receptor complex member 2

Gene Names
Gosr2; Gs27; SNARE; C76855; membrin; 2310032N09Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Golgi SNAP receptor complex member 2; Gosr2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-212aa; full length protein
Sequence
MEPLYQQTNKQVQEIQSHMGRLERADKQSVHLVENEIQASIEQIFSHLERLEILSSKEPLNRRQNAKLRVDQLKYDVQHLQTALRNFQHRRQVREQQERQRDELLSRTFTTNDSDTTIPMDESLQFNSSLHNIHHGMDDLIGGGHSILEGLRAQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCAVMFLVVQYLT
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Gosr2 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Gosr2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,725 Da
NCBI Official Full Name
Golgi SNAP receptor complex member 2
NCBI Official Synonym Full Names
golgi SNAP receptor complex member 2
NCBI Official Symbol
Gosr2
NCBI Official Synonym Symbols
Gs27; SNARE; C76855; membrin; 2310032N09Rik
NCBI Protein Information
Golgi SNAP receptor complex member 2
UniProt Protein Name
Golgi SNAP receptor complex member 2
UniProt Gene Name
Gosr2
UniProt Synonym Gene Names
Gs27
UniProt Entry Name
GOSR2_MOUSE

Uniprot Description

GOSR2: Involved in transport of proteins from the cis/medial- Golgi to the trans-Golgi network. Defects in GOSR2 are the cause of progressive myoclonic epilepsy type 6 (EPM6). A neurologic disorder characterized by onset of ataxia in the first years of life, followed by action myoclonus and seizures later in childhood, and loss of independent ambulation in the second decade. Cognition is not usually affected, although mild memory difficulties may occur in the third decade. Belongs to the GOSR2 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum; Membrane protein, integral

Cellular Component: endoplasmic reticulum membrane; Golgi apparatus; Golgi membrane; late endosome membrane; membrane; SNARE complex

Molecular Function: SNAP receptor activity; SNARE binding

Biological Process: ER to Golgi vesicle-mediated transport; Golgi to vacuole transport; intra-Golgi vesicle-mediated transport; protein targeting to vacuole; retrograde transport, endosome to Golgi; vesicle fusion with Golgi apparatus; vesicle-mediated transport

Similar Products

Product Notes

The Gosr2 gosr2 (Catalog #AAA7042823) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-212aa; full length protein. The amino acid sequence is listed below: MEPLYQQTNK QVQEIQSHMG RLERADKQSV HLVENEIQAS IEQIFSHLER LEILSSKEPL NRRQNAKLRV DQLKYDVQHL QTALRNFQHR RQVREQQERQ RDELLSRTFT TNDSDTTIPM DESLQFNSSL HNIHHGMDDL IGGGHSILEG LRAQRLTLKG TQKKILDIAN MLGLSNTVMR LIEKRAFQDK YFMIGGMLLT CAVMFLVVQY LT. It is sometimes possible for the material contained within the vial of "Golgi SNAP receptor complex member 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.