Ig-like V-type domain-containing protein FAM187A Recombinant Protein | FAM187A recombinant protein
Ig-like V-type domain-containing protein FAM187A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ig-like V-type domain-containing protein FAM187A; FAM187A recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
18-413aa; full length protein
Sequence
FEIVEKENIFQRTPCPAFLMFENAAYLADMSFELPCHCKPEEVPAVVWFYQKHLGSSHTKVLTDFDGRVLTEAAQVRVGSDMLTRFSIRMFSLLVFRAQSEDSGLYFCGTRKGDYFYAYDVDIQNSEGMVATFQDKGQEPFADEYYGHLHVFTTFWEWTPCDRCGVRGEQWRIGLCYLQSPDLSPRYLKAVPDVVSCGSRAVPRKLRTKARDHTPEVLVRSCLVPCEKTKTIREGVLAIINYVSKVGSRPWVPQVPIQFHQQRLGHGLIISCPGARPEHAVAWDKDRQHLYRTQYLKGVNRSMRVFIDHGNQLHIRFTQLDDRGIYYCWRQGVLVAGFRLGVTSHGHYPASFSDPETRSAVELTLIGYLLITAVFVTIHFCRCCCYLFHCCPSFSP
Sequence Length
Full Length Protein
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for FAM187A recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for FAM187A recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
47,349 Da
NCBI Official Full Name
Ig-like V-type domain-containing protein FAM187A
UniProt Protein Name
Ig-like V-type domain-containing protein FAM187A
Protein Family
UniProt Gene Name
FAM187A
UniProt Entry Name
F187A_HUMAN
Uniprot Description
FAM187A: Belongs to the FAM187 family
Chromosomal Location of Human Ortholog: 17q21.31
Similar Products
Product Notes
The FAM187A fam187a (Catalog #AAA7042713) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-413aa; full length protein. The amino acid sequence is listed below: FEIVEKENIF QRTPCPAFLM FENAAYLADM SFELPCHCKP EEVPAVVWFY QKHLGSSHTK VLTDFDGRVL TEAAQVRVGS DMLTRFSIRM FSLLVFRAQS EDSGLYFCGT RKGDYFYAYD VDIQNSEGMV ATFQDKGQEP FADEYYGHLH VFTTFWEWTP CDRCGVRGEQ WRIGLCYLQS PDLSPRYLKA VPDVVSCGSR AVPRKLRTKA RDHTPEVLVR SCLVPCEKTK TIREGVLAII NYVSKVGSRP WVPQVPIQFH QQRLGHGLII SCPGARPEHA VAWDKDRQHL YRTQYLKGVN RSMRVFIDHG NQLHIRFTQL DDRGIYYCWR QGVLVAGFRL GVTSHGHYPA SFSDPETRSA VELTLIGYLL ITAVFVTIHF CRCCCYLFHC CPSFSP. It is sometimes possible for the material contained within the vial of "Ig-like V-type domain-containing protein FAM187A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
