Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha Recombinant Protein | CSF2RA recombinant protein

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

Gene Names
CSF2RA; GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; GM-CSF-R-alpha
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; CSF2RA recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-400aa; full length protein
Sequence
EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Sequence Length
Full Length Protein
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CSF2RA recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for CSF2RA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,101 Da
NCBI Official Full Name
granulocyte-macrophage colony-stimulating factor receptor subunit alpha isoform a
NCBI Official Synonym Full Names
colony stimulating factor 2 receptor alpha subunit
NCBI Official Symbol
CSF2RA
NCBI Official Synonym Symbols
GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; GM-CSF-R-alpha
NCBI Protein Information
granulocyte-macrophage colony-stimulating factor receptor subunit alpha
UniProt Protein Name
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
UniProt Gene Name
CSF2RA
UniProt Synonym Gene Names
CSF2R; CSF2RY; GM-CSF-R-alpha; GMCSFR-alpha; GMR-alpha
UniProt Entry Name
CSF2R_HUMAN

NCBI Description

The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq, Jul 2008]

Uniprot Description

CSF2RA: Low affinity receptor for granulocyte-macrophage colony- stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4). A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress. Belongs to the type I cytokine receptor family. Type 5 subfamily. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp22.32 and Yp11.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: protein binding; protein-tyrosine kinase activity; Ras guanyl-nucleotide exchange factor activity; receptor activity

Biological Process: cellular protein metabolic process; MAPKKK cascade

Disease: Surfactant Metabolism Dysfunction, Pulmonary, 4

Research Articles on CSF2RA

Similar Products

Product Notes

The CSF2RA csf2ra (Catalog #AAA7042582) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-400aa; full length protein. The amino acid sequence is listed below: EKSDLRTVAP ASSLNVRFDS RTMNLSWDCQ ENTTFSKCFL TDKKNRVVEP RLSNNECSCT FREICLHEGV TFEVHVNTSQ RGFQQKLLYP NSGREGTAAQ NFSCFIYNAD LMNCTWARGP TAPRDVQYFL YIRNSKRRRE IRCPYYIQDS GTHVGCHLDN LSGLTSRNYF LVNGTSREIG IQFFDSLLDT KKIERFNPPS NVTVRCNTTH CLVRWKQPRT YQKLSYLDFQ YQLDVHRKNT QPGTENLLIN VSGDLENRYN FPSSEPRAKH SVKIRAADVR ILNWSSWSEA IEFGSDDGNL GSVYIYVLLI VGTLVCGIVL GFLFKRFLRI QRLFPPVPQI KDKLNDNHEV EDEIIWEEFT PEEGKGYREE VLTVKEIT. It is sometimes possible for the material contained within the vial of "Granulocyte-macrophage colony-stimulating factor receptor subunit alpha, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.