B-cell antigen receptor complex-associated protein alpha chain Recombinant Protein | CD79A recombinant protein

B-cell antigen receptor complex-associated protein alpha chain

Cat. Num. AAA7042485

• Gene Names: CD79A; IG-alpha
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: B-cell antigen receptor complex-associated protein alpha chain; CD79A recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 33-236aa; full length protein
• Sequence: LWVDGGPPSMTVSLGETARLQCLHNRSRLSSKLNITWWRVLQGNATWPDIFLSYGKGPNGELTIDTVNKSHMGMYRCQVEEKDLNQKILSSQQSCGTYLRVRERLPRPFLDMGEGTKNNIITAEGIILLFCAVVPGTLLLFRKRWQNMKFGVDAQDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLHIGDGDVQLEKP
• Sequence Length: Full Length Protein

• Species: Canis familiaris (Dog) (Canis lupus familiaris)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CD79A recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for CD79A recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 924859469
• NCBI GeneID: 484483
• NCBI Accession #: NP_001300763.1
• NCBI GenBank Nucleotide #: NM_001313834.1
• UniProt Accession #: P0CAN6
• Molecular Weight: 26,120 Da
• NCBI Official Full Name: B-cell antigen receptor complex-associated protein alpha chain
• NCBI Official Symbol: CD79A
• NCBI Official Synonym Symbols: IG-alpha
• NCBI Protein Information: B-cell antigen receptor complex-associated protein alpha chain
• UniProt Protein Name: B-cell antigen receptor complex-associated protein alpha chain
• Protein Family: B-cell antigen receptor complex-associated protein
• UniProt Gene Name: CD79A
• UniProt Entry Name: CD79A_CANLF

Uniprot Description

Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells ().