Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Platelet glycoprotein 4 Recombinant Protein | CD36 recombinant protein

Platelet glycoprotein 4

Gene Names
CD36; FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Platelet glycoprotein 4; CD36 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-472. Full length of the mature protein.
Sequence
GCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
Sequence Length
472
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CD36 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for CD36 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
948
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,090 Da
NCBI Official Full Name
platelet glycoprotein 4 isoform 1
NCBI Official Synonym Full Names
CD36 molecule
NCBI Official Symbol
CD36
NCBI Official Synonym Symbols
FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10
NCBI Protein Information
platelet glycoprotein 4
UniProt Protein Name
Platelet glycoprotein 4
Protein Family
UniProt Gene Name
CD36
UniProt Synonym Gene Names
GP3B; GP4; FAT; GPIIIB; GPIV
UniProt Entry Name
CD36_HUMAN

NCBI Description

The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2014]

Uniprot Description

CD36: Seems to have numerous potential physiological functions. Binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. May function as a cell adhesion molecule. Directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes. Binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Receptor for thombospondins, THBS1 AND THBS2, mediating their antiangiogenic effects. Defects in CD36 are the cause of platelet glycoprotein IV deficiency (PG4D)[MIM:608404]; also known as CD36 deficiency. Platelet glycoprotein IV deficiency can be divided into 2 subgroups. The type I phenotype is characterized by platelets and monocytes/macrophages exhibiting complete CD36 deficiency. The type II phenotype lacks the surface expression of CD36 in platelets, but expression in monocytes/macrophages is near normal. Genetic variations in CD36 are associated with susceptibility to coronary heart disease type 7 (CHDS7). Belongs to the CD36 family.

Protein type: Cell adhesion; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q11.2

Cellular Component: brush border membrane; cell surface; extracellular space; Golgi apparatus; integral to plasma membrane; lipid raft; membrane; phagocytic vesicle; plasma membrane; platelet alpha granule membrane

Molecular Function: lipid binding; low-density lipoprotein binding; low-density lipoprotein receptor activity; protein binding; transforming growth factor beta binding

Biological Process: antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; blood coagulation; cGMP-mediated signaling; cholesterol absorption; cholesterol transport; elevation of cytosolic calcium ion concentration; interleukin-1 beta secretion; intestinal absorption; lipoprotein transport; MyD88-dependent toll-like receptor signaling pathway; nitric oxide mediated signal transduction; platelet degranulation; positive regulation of cell-matrix adhesion; receptor internalization; receptor-mediated endocytosis; response to lipid; sensory perception of taste; sequestering of lipid; triacylglycerol transport

Disease: Coronary Heart Disease, Susceptibility To, 7; Malaria, Susceptibility To; Platelet Glycoprotein Iv Deficiency

Research Articles on CD36

Similar Products

Product Notes

The CD36 cd36 (Catalog #AAA7042427) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-472. Full length of the mature protein. The amino acid sequence is listed below: GCDRNCGLIA GAVIGAVLAV FGGILMPVGD LLIQKTIKKQ VVLEEGTIAF KNWVKTGTEV YRQFWIFDVQ NPQEVMMNSS NIQVKQRGPY TYRVRFLAKE NVTQDAEDNT VSFLQPNGAI FEPSLSVGTE ADNFTVLNLA VAAASHIYQN QFVQMILNSL INKSKSSMFQ VRTLRELLWG YRDPFLSLVP YPVTTTVGLF YPYNNTADGV YKVFNGKDNI SKVAIIDTYK GKRNLSYWES HCDMINGTDA ASFPPFVEKS QVLQFFSSDI CRSIYAVFES DVNLKGIPVY RFVLPSKAFA SPVENPDNYC FCTEKIISKN CTSYGVLDIS KCKEGRPVYI SLPHFLYASP DVSEPIDGLN PNEEEHRTYL DIEPITGFTL QFAKRLQVNL LVKPSEKIQV LKNLKRNYIV PILWLNETGT IGDEKANMFR SQVTGKINLL GLIEMILLSV GVVMFVAFMI SYCACRSKTI K . It is sometimes possible for the material contained within the vial of "Platelet glycoprotein 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.