CD302 antigen Recombinant Protein | CD302 recombinant protein
CD302 antigen
Gene Names
CD302; DCL-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD302 antigen; CD302 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-232aa; full length protein
Sequence
DCPSSTWVQFQDSCYIFLQEAIKVESIEDVRNQCTNHGADMISIHNEEENAFILDTLKKQWKDPADILLGMFFDTDDASFKWFDNSNMTFNKWSDQEDDEELVDTCAFLHTKTGDWKKGNCEVSSVEGTLCKAAIPYEKKYLSDNRILISALVIASTVILTVLGAVVWFLYKRSLDSGFTTVFSAAHQSPYNDDCVLVVAEENEYDIQFN
Sequence Length
Full Length Protein
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CD302 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for CD302 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,972 Da
NCBI Official Full Name
CD302 antigen
NCBI Official Symbol
CD302
NCBI Official Synonym Symbols
DCL-1
NCBI Protein Information
CD302 antigen
UniProt Protein Name
CD302 antigen
Protein Family
UniProt Gene Name
CD302
UniProt Entry Name
CD302_BOVIN
Uniprot Description
Potential multifunctional C-type lectin receptor that may play roles in endocytosis and phagocytosis as well as in cell adhesion and migration.
Similar Products
Product Notes
The CD302 cd302 (Catalog #AAA7042421) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-232aa; full length protein. The amino acid sequence is listed below: DCPSSTWVQF QDSCYIFLQE AIKVESIEDV RNQCTNHGAD MISIHNEEEN AFILDTLKKQ WKDPADILLG MFFDTDDASF KWFDNSNMTF NKWSDQEDDE ELVDTCAFLH TKTGDWKKGN CEVSSVEGTL CKAAIPYEKK YLSDNRILIS ALVIASTVIL TVLGAVVWFL YKRSLDSGFT TVFSAAHQSP YNDDCVLVVA EENEYDIQFN. It is sometimes possible for the material contained within the vial of "CD302 antigen, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
