Disintegrin and metalloproteinase domain-containing protein 20 Recombinant Protein | ADAM20 recombinant protein
Disintegrin and metalloproteinase domain-containing protein 20
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Disintegrin and metalloproteinase domain-containing protein 20; ADAM20 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
207-726aa; full length protein
Sequence
RFVELVVVVDNIRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKLGVAYVKGICQNPFNTGVDVFEDNRLVVFAITLGHELGHNLGMQHDTQWCVCELQWCIMHAYRKVTTKFSNCSYAQYWDSTISSGLCIQPPPYPGNIFRLKYCGNLVVEEGEECDCGTIRQCAKDPCCLLNCTLHPGAACAFGICCKDCKFLPSGTLCRQQVGECDLPEWCNGTSHQCPDDVYVQDGISCNVNAFCYEKTCNNHDIQCKEIFGQDARSASQSCYQEINTQGNRFGHCGIVGTTYVKCWTPDIMCGRVQCENVGVIPNLIEHSTVQQFHLNDTTCWGTDYHLGMAIPDIGEVKDGTVCGPEKICIRKKCASMVHLSQACQPKTCNMRGICNNKQHCHCNHEWAPPYCKDKGYGGSADSGPPPKNNMEGLNVMGKLRYLSLLCLLPLVAFLLFCLHVLFKKRTKSKEDEEG
Sequence Length
Full Length Protein
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ADAM20 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for ADAM20 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
81,603 Da
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 20 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 20
NCBI Official Symbol
ADAM20
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 20
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 20
Protein Family
UniProt Gene Name
ADAM20
UniProt Synonym Gene Names
ADAM 20
UniProt Entry Name
ADA20_HUMAN
NCBI Description
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The expression of this gene is testis-specific. [provided by RefSeq, Jul 2008]
Uniprot Description
ADAM20: May be involved in sperm maturation and/or fertilization.
Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Protease; EC 3.4.24.-
Chromosomal Location of Human Ortholog: 14q24.1
Cellular Component: plasma membrane
Molecular Function: metallopeptidase activity
Biological Process: binding of sperm to zona pellucida; single fertilization
Similar Products
Product Notes
The ADAM20 adam20 (Catalog #AAA7042086) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 207-726aa; full length protein. The amino acid sequence is listed below: RFVELVVVVD NIRYLFSQSN ATTVQHEVFN VVNIVDSFYH PLEVDVILTG IDIWTASNPL PTSGDLDNVL EDFSIWKNYN LNNRLQHDVA HLFIKDTQGM KLGVAYVKGI CQNPFNTGVD VFEDNRLVVF AITLGHELGH NLGMQHDTQW CVCELQWCIM HAYRKVTTKF SNCSYAQYWD STISSGLCIQ PPPYPGNIFR LKYCGNLVVE EGEECDCGTI RQCAKDPCCL LNCTLHPGAA CAFGICCKDC KFLPSGTLCR QQVGECDLPE WCNGTSHQCP DDVYVQDGIS CNVNAFCYEK TCNNHDIQCK EIFGQDARSA SQSCYQEINT QGNRFGHCGI VGTTYVKCWT PDIMCGRVQC ENVGVIPNLI EHSTVQQFHL NDTTCWGTDY HLGMAIPDIG EVKDGTVCGP EKICIRKKCA SMVHLSQACQ PKTCNMRGIC NNKQHCHCNH EWAPPYCKDK GYGGSADSGP PPKNNMEGLN VMGKLRYLSL LCLLPLVAFL LFCLHVLFKK RTKSKEDEEG. It is sometimes possible for the material contained within the vial of "Disintegrin and metalloproteinase domain-containing protein 20, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
