Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Activin receptor type-1 Recombinant Protein | Acvr1 recombinant protein

Activin receptor type-1

Gene Names
Acvr1; ALK2; Acvr; Alk8; SKR1; Alk-2; Tsk7L; ActR-I; ActRIA; Acvrlk2; D330013D15Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Activin receptor type-1; Acvr1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-509aa; full length protein
Sequence
VEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLAELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Acvr1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Acvr1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,226 Da
NCBI Official Full Name
activin receptor type-1
NCBI Official Synonym Full Names
activin A receptor, type 1
NCBI Official Symbol
Acvr1
NCBI Official Synonym Symbols
ALK2; Acvr; Alk8; SKR1; Alk-2; Tsk7L; ActR-I; ActRIA; Acvrlk2; D330013D15Rik
NCBI Protein Information
activin receptor type-1
UniProt Protein Name
Activin receptor type-1
Protein Family
UniProt Gene Name
Acvr1
UniProt Synonym Gene Names
Acvrlk2; Tgfb1; ACTR-I; SKR1; TSR-I
UniProt Entry Name
ACVR1_MOUSE

Uniprot Description

ALK2: On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis. Interacts with FKBP1A. Interacts with FCHO1. Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.

Protein type: Protein kinase, Ser/Thr (receptor); Kinase, protein; Protein kinase, TKL; EC 2.7.11.30; Membrane protein, integral; TKL group; STKR family; Type1 subfamily

Cellular Component: activin receptor complex; apical part of cell; integral to plasma membrane

Molecular Function: activin binding; activin receptor activity, type I; ATP binding; growth factor binding; protein binding; protein homodimerization activity; protein kinase activity; protein serine/threonine kinase activity; receptor signaling protein serine/threonine kinase activity; SMAD binding; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I

Biological Process: activin receptor signaling pathway; BMP signaling pathway; determination of left/right symmetry; embryonic development; G1/S transition of mitotic cell cycle; gastrulation; gastrulation with mouth forming second; germ cell development; heart development; in utero embryonic development; mesoderm development; mesoderm formation; negative regulation of activin receptor signaling pathway; negative regulation of signal transduction; neural crest cell migration; patterning of blood vessels; peptidyl-threonine phosphorylation; pharyngeal system development; positive regulation of bone mineralization; positive regulation of cell migration; positive regulation of osteoblast differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; protein amino acid phosphorylation; regulation of ossification; smooth muscle cell differentiation; transforming growth factor beta receptor signaling pathway; urogenital system development

Research Articles on Acvr1

Similar Products

Product Notes

The Acvr1 acvr1 (Catalog #AAA7042066) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-509aa; full length protein. The amino acid sequence is listed below: VEDEKPKVNQ KLYMCVCEGL SCGNEDHCEG QQCFSSLSIN DGFHVYQKGC FQVYEQGKMT CKTPPSPGQA VECCQGDWCN RNITAQLPTK GKSFPGTQNF HLEVGLIILS VVFAVCLLAC ILGVALRKFK RRNQERLNPR DVEYGTIEGL ITTNVGDSTL AELLDHSCTS GSGSGLPFLV QRTVARQITL LECVGKGRYG EVWRGSWQGE NVAVKIFSSR DEKSWFRETE LYNTVMLRHE NILGFIASDM TSRHSSTQLW LITHYHEMGS LYDYLQLTTL DTVSCLRIVL SIASGLAHLH IEIFGTQGKS AIAHRDLKSK NILVKKNGQC CIADLGLAVM HSQSTNQLDV GNNPRVGTKR YMAPEVLDET IQVDCFDSYK RVDIWAFGLV LWEVARRMVS NGIVEDYKPP FYDVVPNDPS FEDMRKVVCV DQQRPNIPNR WFSDPTLTSL AKLMKECWYQ NPSARLTALR IKKTLTKIDN SLDKLKTDC. It is sometimes possible for the material contained within the vial of "Activin receptor type-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.