Large envelope protein Recombinant Protein | WhBvgp2 recombinant protein
Recombinant Woodchuck hepatitis B virus Large envelope protein (S)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Large envelope protein; Recombinant Woodchuck hepatitis B virus Large envelope protein (S); WhBvgp2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-431. Full length of the mature protein.
Sequence
GNNIKVTFNPDKIAAWWPAVGTYYTTTYPQNQSVFQPGIYQTTSLINPKNQQELDSVLINRYKQIDWNTWQGFPVDQKLPLVSRDPPPKPYINQSAQTFEIKPGPIIVPGIRDIPRGLVPPQTPTNRDQGRKPTPPTPPLRDTHPHLTMKNQTFHLQGFVDGLRDLTTTERQHNAYGDPFTTLSPAVPTVSTILSPPSTTGDPALSPEMSPSSLLGLLAGLQVVYFLWTKILTIAQNLDWWWTSLSFPGGIPECTGQNSQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLCLIFLLVLLDWKGLIPVCPLQPTTETTVNCRQCTISAQDMYTPPYCCCLKPTAGNCTCWPIPSSWALGNYLWEWALARFSWLNLLVPLLQWLGGISLIAWFLLIWMIWFWGPALLSILPPFIPIFVLFFLIWVYI
Sequence Length
431
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Woodchuck hepatitis B virus (isolate 7) (WHV)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for WhBvgp2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,607 Da
NCBI Official Full Name
surface protein
NCBI Official Symbol
WhBvgp2
NCBI Protein Information
surface protein
UniProt Protein Name
Large envelope protein
Protein Family
UniProt Gene Name
S
UniProt Synonym Gene Names
LHB
UniProt Entry Name
HBSAG_WHV4
Uniprot Description
The large envelope protein exists in two topological conformations, one which is termed 'external' or Le-HBsAg and the other 'internal' or Li-HBsAg. In its external conformation the protein attaches the virus to cell receptors and thereby initiating infection. This interaction determines the species specificity and liver tropism. The large envelope protein probably also assumes fusion between virion and host membranes. In its internal conformation the protein plays a role in virion morphogenesis and mediates the contact with the nucleocapsid like a matrix protein ().
Similar Products
Product Notes
The WhBvgp2 s (Catalog #AAA7041405) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-431. Full length of the mature protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the WhBvgp2 s for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GNNIKVTFNP DKIAAWWPAV GTYYTTTYPQ NQSVFQPGIY QTTSLINPKN QQELDSVLIN RYKQIDWNTW QGFPVDQKLP LVSRDPPPKP YINQSAQTFE IKPGPIIVPG IRDIPRGLVP PQTPTNRDQG RKPTPPTPPL RDTHPHLTMK NQTFHLQGFV DGLRDLTTTE RQHNAYGDPF TTLSPAVPTV STILSPPSTT GDPALSPEMS PSSLLGLLAG LQVVYFLWTK ILTIAQNLDW WWTSLSFPGG IPECTGQNSQ FQTCKHLPTS CPPTCNGFRW MYLRRFIIYL LVLLLCLIFL LVLLDWKGLI PVCPLQPTTE TTVNCRQCTI SAQDMYTPPY CCCLKPTAGN CTCWPIPSSW ALGNYLWEWA LARFSWLNLL VPLLQWLGGI SLIAWFLLIW MIWFWGPALL SILPPFIPIF VLFFLIWVYI . It is sometimes possible for the material contained within the vial of "Large envelope protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
