Putative protein-disulfide oxidoreductase Recombinant Protein | SO_3870 recombinant protein
Recombinant Shewanella oneidensis Putative protein-disulfide oxidoreductase (SO_3870)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative protein-disulfide oxidoreductase; Recombinant Shewanella oneidensis Putative protein-disulfide oxidoreductase (SO_3870); SO_3870 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-212aa; full length protein
Sequence
MSINEVFRSFKAQPVNQLAKIQAERPIWFVMVGAAIFLILSAIFYFQLFLAMAPCEKCVY IRFSQSCIVIAGLIILINPRNNILKTLGLLLAWYAMIQGWIWSFELMKIHDAAHMVVDES MDFFAAAGDAAGSACSTEPRFPLGLPLDKWLPFEFAPTGGCGEDDWALFGLNMAHYCMIA YATFMVCLAPLTLGWFASFMTDRRNTIVYQTR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Shewanella oneidensis (strain MR-1)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SO_3870 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,895 Da
NCBI Official Full Name
disulfide bond formation protein DsbB family
NCBI Official Symbol
SO_3870
NCBI Protein Information
disulfide bond formation protein DsbB family
UniProt Protein Name
Putative protein-disulfide oxidoreductase DsbI
Protein Family
UniProt Gene Name
dsbI
UniProt Entry Name
DSBI_SHEON
Uniprot Description
Required for disulfide bond formation in some proteins. Part of a redox system composed of DsbI and DsbL that mediates formation of an essential disulfide bond in AssT ().
Similar Products
Product Notes
The SO_3870 dsbi (Catalog #AAA7040374) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-212aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SO_3870 dsbi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSINEVFRSF KAQPVNQLAK IQAERPIWFV MVGAAIFLIL SAIFYFQLFL AMAPCEKCVY IRFSQSCIVI AGLIILINPR NNILKTLGLL LAWYAMIQGW IWSFELMKIH DAAHMVVDES MDFFAAAGDA AGSACSTEPR FPLGLPLDKW LPFEFAPTGG CGEDDWALFG LNMAHYCMIA YATFMVCLAP LTLGWFASFM TDRRNTIVYQ TR. It is sometimes possible for the material contained within the vial of "Putative protein-disulfide oxidoreductase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
