2-hydroxyacylsphingosine 1-beta-galactosyltransferase (Ugt8) Recombinant Protein | Ugt8 recombinant protein
Recombinant Mouse 2-hydroxyacylsphingosine 1-beta-galactosyltransferase (Ugt8)
Gene Names
Ugt8a; Cgt; Ugt8; mCerGT; AI850488; AW455908
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
2-hydroxyacylsphingosine 1-beta-galactosyltransferase (Ugt8); Recombinant Mouse 2-hydroxyacylsphingosine 1-beta-galactosyltransferase (Ugt8); Ugt8 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-541aa; full length protein
Sequence
AKIIIVPPIMFESHLYIFKTLASALHERGHHTVLLLSEGRDIAPSNHYSLQRYPGIFNST TSDAFLQSKMRNIFSGRLTAVELVDILDHYTKNCDMMVGNQALIQGLKKEKFDLLLVDPN DMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNFLERMKNTGVY LISRIGVSFLVLPKYERIMQKYNLLPAKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVY VGGILTKPASPLPEDLQRWVSGAQEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVI WRFSGTKPKNLGNNTKLIEWLPQNDLLGHSNIRAFLSHGGLNSIFETMYHGVPVVGIPLF GDHYDTMTRVQAKGMGILLEWNTVTEGELYDALVKVINNPSYRQRAQKLSEIHKDQPGHP VNRTTYWIDYILRHDGARHLRSAVHQISFCQYFLLDIAFVLLLGAVLLYFILSYVTKFIY RKIKSLWSKNEHSTVNGHYQNGIRNGKYKGNGRVKHEKKVR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ugt8 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
61,249 Da
NCBI Official Full Name
2-hydroxyacylsphingosine 1-beta-galactosyltransferase
NCBI Official Synonym Full Names
UDP galactosyltransferase 8A
NCBI Official Symbol
Ugt8a
NCBI Official Synonym Symbols
Cgt; Ugt8; mCerGT; AI850488; AW455908
NCBI Protein Information
2-hydroxyacylsphingosine 1-beta-galactosyltransferase
UniProt Protein Name
2-hydroxyacylsphingosine 1-beta-galactosyltransferase
Protein Family
UniProt Gene Name
Ugt8
UniProt Synonym Gene Names
Cgt; Ugt4; Ugt8a
UniProt Entry Name
CGT_MOUSE
Uniprot Description
UGT8: Catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Belongs to the UDP-glycosyltransferase family.
Protein type: Membrane protein, integral; EC 2.4.1.45; Transferase; Lipid Metabolism - sphingolipid
Cellular Component: integral to membrane; intracellular membrane-bound organelle; membrane
Molecular Function: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase activity; ceramide glucosyltransferase activity; glucuronosyltransferase activity; transferase activity; transferase activity, transferring glycosyl groups; transferase activity, transferring hexosyl groups; UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity
Biological Process: cytoskeleton organization and biogenesis; flavonoid biosynthetic process; glycolipid biosynthetic process; lipid metabolic process; metabolic process; myelination; neurite morphogenesis; paranodal junction assembly; sphingolipid metabolic process
Research Articles on Ugt8
Similar Products
Product Notes
The Ugt8 ugt8 (Catalog #AAA7032847) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-541aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ugt8 ugt8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AKIIIVPPIM FESHLYIFKT LASALHERGH HTVLLLSEGR DIAPSNHYSL QRYPGIFNST TSDAFLQSKM RNIFSGRLTA VELVDILDHY TKNCDMMVGN QALIQGLKKE KFDLLLVDPN DMCGFVIAHL LGVKYAVFST GLWYPAEVGA PAPLAYVPEF NSLLTDRMNF LERMKNTGVY LISRIGVSFL VLPKYERIMQ KYNLLPAKSM YDLVHGSSLW MLCTDVALEF PRPTLPNVVY VGGILTKPAS PLPEDLQRWV SGAQEHGFVL VSFGAGVKYL SEDIANKLAG ALGRLPQKVI WRFSGTKPKN LGNNTKLIEW LPQNDLLGHS NIRAFLSHGG LNSIFETMYH GVPVVGIPLF GDHYDTMTRV QAKGMGILLE WNTVTEGELY DALVKVINNP SYRQRAQKLS EIHKDQPGHP VNRTTYWIDY ILRHDGARHL RSAVHQISFC QYFLLDIAFV LLLGAVLLYF ILSYVTKFIY RKIKSLWSKN EHSTVNGHYQ NGIRNGKYKG NGRVKHEKKV R. It is sometimes possible for the material contained within the vial of "2-hydroxyacylsphingosine 1-beta-galactosyltransferase (Ugt8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
