Short transient receptor potential channel 1 (Trpc1) Recombinant Protein | Trpc1 recombinant protein
Recombinant Mouse Short transient receptor potential channel 1 (Trpc1)
Gene Names
Trpc1; Trp1; Mtrp1; Trrp1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Short transient receptor potential channel 1 (Trpc1); Recombinant Mouse Short transient receptor potential channel 1 (Trpc1); Trpc1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-793aa; full length protein
Sequence
MMAALYPSTDLSGVSSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY YMVKKILEENSSGDLNINCVDVLGRNAVTITIENESLDILQLLLDYGCQSADALLVAIDS EVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLK QDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFEL SADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGL LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIF WPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPAL ERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKF HDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKF LGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFS LAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEW KFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEW RNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLG FRTSKYAMFYPRN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Trpc1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
87,618 Da
NCBI Official Full Name
short transient receptor potential channel 1 isoform 2
NCBI Official Synonym Full Names
transient receptor potential cation channel, subfamily C, member 1
NCBI Official Symbol
Trpc1
NCBI Official Synonym Symbols
Trp1; Mtrp1; Trrp1
NCBI Protein Information
short transient receptor potential channel 1
UniProt Protein Name
Short transient receptor potential channel 1
Protein Family
UniProt Gene Name
Trpc1
UniProt Synonym Gene Names
Trp1; Trrp1; TrpC1; TRP-1; mTrp1
UniProt Entry Name
TRPC1_MOUSE
Uniprot Description
TRPC1: Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Seems to be also activated by intracellular calcium store depletion. Belongs to the transient receptor (TC 1.A.4) family. STrpC subfamily. TRPC1 sub-subfamily. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Channel, calcium; Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: basolateral plasma membrane; costamere; cytoplasm; integral to membrane; integral to plasma membrane; lipid raft; membrane; plasma membrane; protein complex; receptor complex; sarcomere
Molecular Function: calcium channel activity; cation channel activity; ion channel activity; protein binding; store-operated calcium channel activity
Biological Process: calcium ion transport; cytosolic calcium ion homeostasis; ion transport; manganese ion transport; melanin biosynthetic process; positive regulation of release of sequestered calcium ion into cytosol; response to calcium ion; saliva secretion; transmembrane transport; transport
Research Articles on Trpc1
Similar Products
Product Notes
The Trpc1 trpc1 (Catalog #AAA7032196) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-793aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Trpc1 trpc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMAALYPSTD LSGVSSSSLP SSPSSSSPNE VMALKDVREV KEENTLNEKL FLLACDKGDY YMVKKILEEN SSGDLNINCV DVLGRNAVTI TIENESLDIL QLLLDYGCQS ADALLVAIDS EVVGAVDILL NHRPKRSSRP TIVKLMERIQ NPEYSTTMDV APVILAAHRN NYEILTMLLK QDVSLPKPHA VGCECTLCSA KNKKDSLRHS RFRLDIYRCL ASPALIMLTE EDPILRAFEL SADLKELSLV EVEFRNDYEE LARQCKMFAK DLLAQARNSR ELEVILNHTS SDEPLDKRGL LEERMNLSRL KLAIKYNQKE FVSQSNCQQF LNTVWFGQMS GYRRKPTCKK IMTVLTVGIF WPVLSLCYLI APKSQFGRII HTPFMKFIIH GASYFTFLLL LNLYSLVYNE DKKNTMGPAL ERIDYLLILW IIGMIWSDIK RLWYEGLEDF LEESRNQLSF VMNSLYLATF ALKVVAHNKF HDFADRKDWD AFHPTLVAEG LFAFANVLSY LRLFFMYTTS SILGPLQISM GQMLQDFGKF LGMFLLVLFS FTIGLTQLYD KGYTSKEQKD CVGIFCEQQS NDTFHSFIGT CFALFWYIFS LAHVAIFVTR FSYGEELQSF VGAVIVGTYN VVVVIVLTKL LVAMLHKSFQ LIANHEDKEW KFARAKLWLS YFDDKCTLPP PFNIIPSPKT ICYMISSLSK WICSHTSKGK VKRQNSLKEW RNLKQKRDEN YQKVMCCLVH RYLTSMRQKM QSTDQATVEN LNELRQDLSK FRNEIRDLLG FRTSKYAMFY PRN. It is sometimes possible for the material contained within the vial of "Short transient receptor potential channel 1 (Trpc1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
