Tetraspanning orphan receptor (TOR) Recombinant Protein | TOR recombinant protein
Recombinant Schistosoma mansoni Tetraspanning orphan receptor (TOR)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tetraspanning orphan receptor (TOR); Recombinant Schistosoma mansoni Tetraspanning orphan receptor (TOR); TOR recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-419aa; full length protein
Sequence
MPRAPALLTNDARHQFTCCLCLHVRTGTIIFGITQIIIQLVFISFLFLMTFNPRLIPEDN HGNTDPSEDKIRFYVFSTLFRLVPAVSDIHESLTLPSPGTRNVNGNKLYLGHNVESETNF NYDIPPGYKDDVLVDVNNMSPSLVSYTQKNERGSHEVKIKHFSPYIAVCVTTFSLAFCCF MVHGAITKQPTHLLPFFFIQVFDLIICLIHILGFMSSTSDLRLMIHTKTGPIYIKSTGFT FIILSISCMMLAFKAYCLGMVWDCYKYLMLNRRGNLLDDWYSDQWGHLSTFWSLLRAGRN RGNNSIGNSGSPNEPNTRPRPEPITYDPANDLPKYEDILKIPANAYAPPPYYCSNINGNV NTTEASAVTTNTSNSATAANTTTTTTNTGTTTSVISTLTTTNKDDTQINSAPSNAHSSC
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Schistosoma mansoni (Blood fluke)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for TOR recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
46,712 Da
NCBI Official Full Name
Tetraspanning orphan receptor
UniProt Protein Name
Tetraspanning orphan receptor
Protein Family
UniProt Gene Name
TOR
UniProt Synonym Gene Names
Sm-TOR
UniProt Entry Name
TOR_SCHMA
Uniprot Description
Cell surface receptor that binds to human complement C2a protein. This results in inhibition of the classical and lectin pathways of complement activation, probably due to interference with binding of C2a to C4b and interference with cleavage by C1 or MASP2 such that C3 convertase cannot be formed. This infers resistance to complement-mediated cell lysis, allowing parasite survival and infection ().
Similar Products
Product Notes
The TOR tor (Catalog #AAA7032067) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-419aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the TOR tor for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPRAPALLTN DARHQFTCCL CLHVRTGTII FGITQIIIQL VFISFLFLMT FNPRLIPEDN HGNTDPSEDK IRFYVFSTLF RLVPAVSDIH ESLTLPSPGT RNVNGNKLYL GHNVESETNF NYDIPPGYKD DVLVDVNNMS PSLVSYTQKN ERGSHEVKIK HFSPYIAVCV TTFSLAFCCF MVHGAITKQP THLLPFFFIQ VFDLIICLIH ILGFMSSTSD LRLMIHTKTG PIYIKSTGFT FIILSISCMM LAFKAYCLGM VWDCYKYLML NRRGNLLDDW YSDQWGHLST FWSLLRAGRN RGNNSIGNSG SPNEPNTRPR PEPITYDPAN DLPKYEDILK IPANAYAPPP YYCSNINGNV NTTEASAVTT NTSNSATAAN TTTTTTNTGT TTSVISTLTT TNKDDTQINS APSNAHSSC. It is sometimes possible for the material contained within the vial of "Tetraspanning orphan receptor (TOR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
