Protein SYS1 homolog (SYS1) Recombinant Protein | SYS1 recombinant protein
Recombinant Human Protein SYS1 homolog (SYS1)
Gene Names
SYS1; C20orf169; dJ453C12.4; dJ453C12.4.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein SYS1 homolog (SYS1); Recombinant Human Protein SYS1 homolog (SYS1); SYS1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-156aa; full length protein
Sequence
MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFST PPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWW LVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SYS1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
8,444 Da
NCBI Official Full Name
protein SYS1 homolog isoform b
NCBI Official Synonym Full Names
Sys1 golgi trafficking protein
NCBI Official Symbol
SYS1
NCBI Official Synonym Symbols
C20orf169; dJ453C12.4; dJ453C12.4.1
NCBI Protein Information
protein SYS1 homolog
UniProt Protein Name
Protein SYS1 homolog
Protein Family
UniProt Gene Name
SYS1
UniProt Synonym Gene Names
C20orf169
UniProt Entry Name
SYS1_HUMAN
NCBI Description
SYS1 forms a complex with ADP-ribosylation factor-related protein ARFRP1 (MIM 604699) and targets ARFRP1 to the Golgi apparatus (Behnia et al., 2004 [PubMed 15077113]).[supplied by OMIM, Aug 2009]
Uniprot Description
SYS1: Involved in protein trafficking. May serve as a receptor for ARFRP1. Belongs to the SYS1 family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 20q13.12
Cellular Component: cytosol; integral to Golgi membrane; trans-Golgi network; trans-Golgi network membrane
Biological Process: Golgi to endosome transport; Golgi to plasma membrane protein transport; protein targeting to Golgi
Similar Products
Product Notes
The SYS1 sys1 (Catalog #AAA7030772) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-156aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SYS1 sys1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGQFRSYVW DPLLILSQIV LMQTVYYGSL GLWLALVDGL VRSSPSLDQM FDAEILGFST PPGRLSMMSF ILNALTCALG LLYFIRRGKQ CLDFTVTVHF FHLLGCWFYS SRFPSALTWW LVQAVCIALM AVIGEYLCMR TELKEIPLNS APKSNV. It is sometimes possible for the material contained within the vial of "Protein SYS1 homolog (SYS1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
