Western Blot (WB)
(Host: RabbitTarget Name: SYS1Sample Type: OVCAR-3 Whole CellAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human SYS1 Polyclonal Antibody | anti-SYS1 antibody
SYS1 Antibody - C-terminal
Gene Names
SYS1; C20orf169; dJ453C12.4; dJ453C12.4.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SYS1; Polyclonal Antibody; SYS1 Antibody - C-terminal; anti-SYS1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSN
Sequence Length
156
Applicable Applications for anti-SYS1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SYS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SYS1Sample Type: OVCAR-3 Whole CellAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SYS1Sample Type: OVCAR-3 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SYS1 antibody
This is a rabbit polyclonal antibody against SYS1. It was validated on Western Blot
Target Description: SYS1 forms a complex with ADP-ribosylation factor-related protein ARFRP1 (MIM 604699) and targets ARFRP1 to the Golgi apparatus.
Target Description: SYS1 forms a complex with ADP-ribosylation factor-related protein ARFRP1 (MIM 604699) and targets ARFRP1 to the Golgi apparatus.
Product Categories/Family for anti-SYS1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
protein SYS1 homolog isoform a
NCBI Official Synonym Full Names
SYS1 golgi trafficking protein
NCBI Official Symbol
SYS1
NCBI Official Synonym Symbols
C20orf169; dJ453C12.4; dJ453C12.4.1
NCBI Protein Information
protein SYS1 homolog
UniProt Protein Name
Protein SYS1 homolog
Protein Family
UniProt Gene Name
SYS1
UniProt Synonym Gene Names
C20orf169
NCBI Description
SYS1 forms a complex with ADP-ribosylation factor-related protein ARFRP1 (MIM 604699) and targets ARFRP1 to the Golgi apparatus (Behnia et al., 2004 [PubMed 15077113]).[supplied by OMIM, Aug 2009]
Uniprot Description
SYS1: Involved in protein trafficking. May serve as a receptor for ARFRP1. Belongs to the SYS1 family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 20q13.12
Cellular Component: cytosol; integral to Golgi membrane; trans-Golgi network; trans-Golgi network membrane
Biological Process: Golgi to endosome transport; Golgi to plasma membrane protein transport; protein targeting to Golgi
Similar Products
Product Notes
The SYS1 sys1 (Catalog #AAA3219612) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYS1 Antibody - C-terminal reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SYS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYS1 sys1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CWFYSSRFPS ALTWWLVQAV CIALMAVIGE YLCMRTELKE IPLNSAPKSN. It is sometimes possible for the material contained within the vial of "SYS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
