Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Smoothened homolog (Smo) Recombinant Protein | Smo recombinant protein

Recombinant Rat Smoothened homolog (Smo)

Gene Names
Smo; Smoh
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Smoothened homolog (Smo); Recombinant Rat Smoothened homolog (Smo); Smo recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
31-793aa; Full length protein
Sequence
RGAALSGNVTGPGPRSAGGSARRNAPVTSPPPPLLSHCGRAAHCEPLRYNVCLGSALPYG ATTTLLAGDSDSQEEAHSKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTL CQATRGPCAIVERERGWPDFLRCTPDHFPEGCPNEVQNIKFNSSGQCEAPLVRTDNPKSW YEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVI LFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRFGEPTSSETLSCVIIFVIVYYALM AGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSV SGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKIN ETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKKPIPD CEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGHSDDEPKRIKKS KMIAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAGLAFELNEPSADVSSAWAQHVTKMV ARRGAILPQDVSVTPVATPVPPEEQANLWLVEAEISPELEKRLGRKKKRRKRKKEVCPLG PAPELHHSAPVPATSAVPRLPQLPRQKCLVAANAWGTGEPCRQGAWTVVSNPFCPEPSPH QDPFLPGASAPRVWAQGRLQGLGSIHSRTNLMEAELLDADSDF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Smo recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,376 Da
NCBI Official Full Name
smoothened homolog
NCBI Official Synonym Full Names
smoothened, frizzled class receptor
NCBI Official Symbol
Smo
NCBI Official Synonym Symbols
Smoh
NCBI Protein Information
smoothened homolog
UniProt Protein Name
Smoothened homolog
Protein Family
UniProt Gene Name
Smo
UniProt Synonym Gene Names
Smoh; SMO
UniProt Entry Name
SMO_RAT

NCBI Description

may act as a signaling component of the Patched (Ptch) signaling pathway [RGD, Feb 2006]

Uniprot Description

SMO: G protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce the hedgehog's proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7 and GLI3 in the cilia. Belongs to the G-protein coupled receptor Fz/Smo family.

Protein type: GPCR, Fz/Smo family; Membrane protein, integral; Oncoprotein; Cell development/differentiation; Membrane protein, multi-pass; Receptor, GPCR

Cellular Component: caveola; cell soma; cilium; cytoplasm; dendrite; Golgi apparatus; integral to membrane; intracellular membrane-bound organelle; plasma membrane; postsynaptic density

Molecular Function: drug binding; G-protein coupled receptor activity; patched binding; transmembrane receptor activity; Wnt receptor activity; Wnt-protein binding

Biological Process: activation of hh target transcription factor; anterior/posterior pattern formation; astrocyte activation; axon extension involved in axon guidance; cell development; cell fate specification; central nervous system development; central nervous system neuron differentiation; cerebellar cortex morphogenesis; cerebral cortex development; dentate gyrus development; determination of left/right symmetry; developmental growth; dorsal/ventral pattern formation; dorsoventral neural tube patterning; embryonic organ development; facial nerve development; forebrain morphogenesis; G-protein coupled receptor protein signaling pathway; gut development; hair follicle morphogenesis; heart looping; heart morphogenesis; homeostasis of number of cells within a tissue; in utero embryonic development; midgut development; multicellular organism growth; myoblast migration; negative regulation of apoptosis; negative regulation of DNA binding; negative regulation of epithelial cell differentiation; negative regulation of hair follicle development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; neural crest cell migration; neurite regeneration; odontogenesis of dentine-containing teeth; ossification; osteoblast differentiation; osteoblast proliferation; pattern specification process; positive regulation of cell proliferation; positive regulation of epithelial cell proliferation; positive regulation of mesenchymal cell proliferation; positive regulation of multicellular organism growth; positive regulation of neuroblast proliferation; positive regulation of organ growth; positive regulation of protein import into nucleus; positive regulation of smoothened signaling pathway; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; protein stabilization; regulation of gene expression; response to organic substance; response to wounding; skeletal muscle fiber development; smoothened signaling pathway; smoothened signaling pathway in regulation of granule cell precursor cell proliferation; smoothened signaling pathway in ventral spinal cord patterning; spermatogenesis; thalamus development; vasculogenesis; ventral midline determination; Wnt receptor signaling pathway through beta-catenin

Research Articles on Smo

Similar Products

Product Notes

The Smo smo (Catalog #AAA7030171) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-793aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Smo smo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RGAALSGNVT GPGPRSAGGS ARRNAPVTSP PPPLLSHCGR AAHCEPLRYN VCLGSALPYG ATTTLLAGDS DSQEEAHSKL VLWSGLRNAP RCWAVIQPLL CAVYMPKCEN DRVELPSRTL CQATRGPCAI VERERGWPDF LRCTPDHFPE GCPNEVQNIK FNSSGQCEAP LVRTDNPKSW YEDVEGCGIQ CQNPLFTEAE HQDMHSYIAA FGAVTGLCTL FTLATFVADW RNSNRYPAVI LFYVNACFFV GSIGWLAQFM DGARREIVCR ADGTMRFGEP TSSETLSCVI IFVIVYYALM AGVVWFVVLT YAWHTSFKAL GTTYQPLSGK TSYFHLLTWS LPFVLTVAIL AVAQVDGDSV SGICFVGYKN YRYRAGFVLA PIGLVLIVGG YFLIRGVMTL FSIKSNHPGL LSEKAASKIN ETMLRLGIFG FLAFGFVLIT FSCHFYDFFN QAEWERSFRD YVLCQANVTI GLPTKKPIPD CEIKNRPSLL VEKINLFAMF GTGIAMSTWV WTKATLLIWR RTWCRLTGHS DDEPKRIKKS KMIAKAFSKR RELLQNPGQE LSFSMHTVSH DGPVAGLAFE LNEPSADVSS AWAQHVTKMV ARRGAILPQD VSVTPVATPV PPEEQANLWL VEAEISPELE KRLGRKKKRR KRKKEVCPLG PAPELHHSAP VPATSAVPRL PQLPRQKCLV AANAWGTGEP CRQGAWTVVS NPFCPEPSPH QDPFLPGASA PRVWAQGRLQ GLGSIHSRTN LMEAELLDAD SDF. It is sometimes possible for the material contained within the vial of "Smoothened homolog (Smo), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.