Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Reticulon-2 (RTN2) Recombinant Protein | RTN2 recombinant protein

Recombinant Human Reticulon-2 (RTN2)

Gene Names
RTN2; NSP2; NSPL1; NSPLI; SPG12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Reticulon-2 (RTN2); Recombinant Human Reticulon-2 (RTN2); RTN2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-545aa; Full length protein
Sequence
MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEETTSQDWGTPR ELTFSYIAFDGVVGSGGRRDSTARRPRPQGRSVSEPRDQHPQPSLGDSLESIPSLSQSPE PGRRGDPDTAPPSERPLEDLRLRLDHLGWVARGTGSGEDSSTSSSTPLEDEEPQEPNRLE TGEAGEELDLRLRLAQPSSPEVLTPQLSPGSGTPQAGTPSPSRSRDSNSGPEEPLLEEEE KQWGPLEREPVRGQCLDSTDQLEFTVEPRLLGTAMEWLKTSLLLAVYKTVPILELSPPLW TAIGWVQRGPTPPTPVLRVLLKWAKSPRSSGVPSLSLGADMGSKVADLLYWKDTRTSGVV FTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGANPFQAYLDVD LTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTL LILGVIGLFTIPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGALASAAAAVSGS KAKAE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for RTN2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,316 Da
NCBI Official Full Name
reticulon-2 isoform A
NCBI Official Synonym Full Names
reticulon 2
NCBI Official Symbol
RTN2
NCBI Official Synonym Symbols
NSP2; NSPL1; NSPLI; SPG12
NCBI Protein Information
reticulon-2
UniProt Protein Name
Reticulon-2
Protein Family
UniProt Gene Name
RTN2
UniProt Synonym Gene Names
NSPL1; NSP-like protein 1; NSP-like protein I; NSPLI
UniProt Entry Name
RTN2_HUMAN

NCBI Description

This gene belongs to the family of reticulon encoding genes. Reticulons are necessary for proper generation of tubular endoplasmic reticulum and likely play a role in intracellular vesicular transport. Alternatively spliced transcript variants encoding different isoforms have been identified. Mutations at this locus have been associated with autosomal dominant spastic paraplegia-12. [provided by RefSeq, Apr 2012]

Uniprot Description

RTN2: Defects in RTN2 are the cause of spastic paraplegia autosomal dominant type 12 (SPG12). A form of spastic paraplegia, a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: endoplasmic reticulum; integral to endoplasmic reticulum membrane; T-tubule

Molecular Function: protein binding

Biological Process: intracellular protein transport across a membrane; regulation of glucose import

Disease: Spastic Paraplegia 12, Autosomal Dominant

Research Articles on RTN2

Similar Products

Product Notes

The RTN2 rtn2 (Catalog #AAA7029158) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-545aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the RTN2 rtn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGQVLPVFAH CKEAPSTASS TPDSTEGGND DSDFRELHTA REFSEEDEEE TTSQDWGTPR ELTFSYIAFD GVVGSGGRRD STARRPRPQG RSVSEPRDQH PQPSLGDSLE SIPSLSQSPE PGRRGDPDTA PPSERPLEDL RLRLDHLGWV ARGTGSGEDS STSSSTPLED EEPQEPNRLE TGEAGEELDL RLRLAQPSSP EVLTPQLSPG SGTPQAGTPS PSRSRDSNSG PEEPLLEEEE KQWGPLEREP VRGQCLDSTD QLEFTVEPRL LGTAMEWLKT SLLLAVYKTV PILELSPPLW TAIGWVQRGP TPPTPVLRVL LKWAKSPRSS GVPSLSLGAD MGSKVADLLY WKDTRTSGVV FTGLMVSLLC LLHFSIVSVA AHLALLLLCG TISLRVYRKV LQAVHRGDGA NPFQAYLDVD LTLTREQTER LSHQITSRVV SAATQLRHFF LVEDLVDSLK LALLFYILTF VGAIFNGLTL LILGVIGLFT IPLLYRQHQA QIDQYVGLVT NQLSHIKAKI RAKIPGTGAL ASAAAAVSGS KAKAE. It is sometimes possible for the material contained within the vial of "Reticulon-2 (RTN2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.