Neuropeptide Y receptor type 4 (Ppyr1) Recombinant Protein | Ppyr1 recombinant protein
Recombinant Mouse Neuropeptide Y receptor type 4 (Ppyr1)
Gene Names
Npy4r; Y4; Ppyr1; NYYR-D
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neuropeptide Y receptor type 4 (Ppyr1); Recombinant Mouse Neuropeptide Y receptor type 4 (Ppyr1); Ppyr1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-375aa; full length protein
Sequence
MNTSHFLAPLFPGSLQGKNGTNPLDSPYNFSDGCQDSAELLAFIITTYSIETILGVLGNL CLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFI QCMSVTVSILSLVLVALERHQLIINPTGWKPSIFQAYLGIVVIWFVSCFLSLPFLANSTL NDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCIPLAFILVCYIRIYQR LQRQKHVFHAHACSSRAGQMKRINSMLMTMVTAFAVLWLPLHVFNTLEDWYQEAIPACHG NLIFLMCHLLAMASTCVNPFIYGFLNINFKKDIKALVLTCHCRSPRGESEHLPLSTVHTD LSKGSMRMGSKSNFI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ppyr1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,648 Da
NCBI Official Full Name
neuropeptide Y receptor type 4
NCBI Official Synonym Full Names
neuropeptide Y receptor Y4
NCBI Official Symbol
Npy4r
NCBI Official Synonym Symbols
Y4; Ppyr1; NYYR-D
NCBI Protein Information
neuropeptide Y receptor type 4
UniProt Protein Name
Neuropeptide Y receptor type 4
UniProt Gene Name
Npy4r
UniProt Synonym Gene Names
Ppyr1; NPY4-R; PP1
UniProt Entry Name
NPY4R_MOUSE
Uniprot Description
NPY4R: Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PP, PP (2-36) and [Ile-31, Gln-34] PP > [Pro-34] PYY > PYY and [Leu-31, Pro-34] NPY > NPY > PYY (3-36) and NPY (2-36) > PP (13- 36) > PP (31-36) > NPY free acid. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1; Membrane protein, integral
Cellular Component: integral to membrane; integral to plasma membrane; membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity; neuropeptide Y receptor activity; pancreatic polypeptide receptor activity; peptide binding; peptide YY receptor activity; signal transducer activity
Biological Process: blood circulation; cell surface receptor linked signal transduction; feeding behavior; G-protein coupled receptor protein signaling pathway; signal transduction
Research Articles on Ppyr1
Similar Products
Product Notes
The Ppyr1 npy4r (Catalog #AAA7026910) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-375aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ppyr1 npy4r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNTSHFLAPL FPGSLQGKNG TNPLDSPYNF SDGCQDSAEL LAFIITTYSI ETILGVLGNL CLIFVTTRQK EKSNVTNLLI ANLAFSDFLM CLICQPLTVT YTIMDYWIFG EVLCKMLTFI QCMSVTVSIL SLVLVALERH QLIINPTGWK PSIFQAYLGI VVIWFVSCFL SLPFLANSTL NDLFHYNHSK VVEFLEDKVV CFVSWSSDHH RLIYTTFLLL FQYCIPLAFI LVCYIRIYQR LQRQKHVFHA HACSSRAGQM KRINSMLMTM VTAFAVLWLP LHVFNTLEDW YQEAIPACHG NLIFLMCHLL AMASTCVNPF IYGFLNINFK KDIKALVLTC HCRSPRGESE HLPLSTVHTD LSKGSMRMGS KSNFI. It is sometimes possible for the material contained within the vial of "Neuropeptide Y receptor type 4 (Ppyr1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
