Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

P2Y purinoceptor 12 (P2ry12) Recombinant Protein | P2ry12 recombinant protein

Recombinant Mouse P2Y purinoceptor 12 (P2ry12)

Gene Names
P2ry12; P2Y12; 2900079B22Rik; 4921504D23Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
P2Y purinoceptor 12 (P2ry12); Recombinant Mouse P2Y purinoceptor 12 (P2ry12); P2ry12 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-347aa; full length protein
Sequence
MDVPGVNTTSANTTFSPGTSTLCVRDYKITQVLFPLLYTVLFFAGLITNSLAMRIFFQIR SKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGPLRTLVCQVTSVTFYFTMYISISF LGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDKDVTK CSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGSAKVPKKKV NVKVFIIIAVFFICFVPFHFARIPYTLSQTRAVFDCSAENTLFYVKESTLWLTSLNACLD PFIYFFLCKSFRNSLTSMLRCSNSTSTSGTNKKKGQEGGEPSEETPM
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for P2ry12 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,474 Da
NCBI Official Full Name
P2Y purinoceptor 12
NCBI Official Synonym Full Names
purinergic receptor P2Y, G-protein coupled 12
NCBI Official Symbol
P2ry12
NCBI Official Synonym Symbols
P2Y12; 2900079B22Rik; 4921504D23Rik
NCBI Protein Information
P2Y purinoceptor 12
UniProt Protein Name
P2Y purinoceptor 12
Protein Family
UniProt Gene Name
P2ry12
UniProt Synonym Gene Names
P2Y12
UniProt Entry Name
P2Y12_MOUSE

Uniprot Description

P2Y12: Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Involved in platelets aggregation. Defects in P2RY12 are the cause of bleeding disorder platelet-type 8 (BDPLT8). A condition characterized by mild to moderate mucocutaneous bleeding, and excessive bleeding after surgery or trauma. The defect is due to severe impairment of platelet response to ADP resulting in defective platelet aggregation. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; GPCR, family 1; Mitochondrial; Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: basal plasma membrane; caveola; cell surface; external side of plasma membrane; integral to membrane; integral to plasma membrane; intracellular; intrinsic to membrane; membrane; mitochondrion; plasma membrane

Molecular Function: adenosine receptor activity, G-protein coupled; G-protein coupled receptor activity; platelet ADP receptor activity; purinergic nucleotide receptor activity, G-protein coupled; signal transducer activity

Biological Process: adenosine receptor signaling pathway; blood coagulation; cell projection organization and biogenesis; G-protein coupled receptor protein signaling pathway; G-protein signaling, adenylate cyclase inhibiting pathway; G-protein signaling, coupled to cAMP nucleotide second messenger; glial cell migration; hemostasis; negative regulation of cell differentiation; platelet activation; positive regulation of ion transport; protein kinase B signaling cascade; regulation of calcium ion transport; signal transduction; substrate-bound cell migration, cell extension

Research Articles on P2ry12

Similar Products

Product Notes

The P2ry12 p2ry12 (Catalog #AAA7025275) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-347aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the P2ry12 p2ry12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDVPGVNTTS ANTTFSPGTS TLCVRDYKIT QVLFPLLYTV LFFAGLITNS LAMRIFFQIR SKSNFIIFLK NTVISDLLMI LTFPFKILSD AKLGAGPLRT LVCQVTSVTF YFTMYISISF LGLITIDRYL KTTRPFKTSS PSNLLGAKIL SVVIWAFMFL ISLPNMILTN RRPKDKDVTK CSFLKSEFGL VWHEIVNYIC QVIFWINFLI VIVCYSLITK ELYRSYVRTR GSAKVPKKKV NVKVFIIIAV FFICFVPFHF ARIPYTLSQT RAVFDCSAEN TLFYVKESTL WLTSLNACLD PFIYFFLCKS FRNSLTSMLR CSNSTSTSGT NKKKGQEGGE PSEETPM. It is sometimes possible for the material contained within the vial of "P2Y purinoceptor 12 (P2ry12), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.