NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13) Recombinant Protein | NDUFA13 recombinant protein

Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13)

Gene Names

NDUFA13; GRIM19

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13); Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13); NDUFA13 recombinant protein

Ordering
Cat. Num. AAA7023205 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

Cell Free Expression

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Liquid containing glycerol

Sequence Positions

2-144aa; full length protein

Sequence

AASKVKQDMPPVGGYGPIDYKRNLPRRGLSGYSMFAVGIGALLFGYWSMMKWNRERRRLQ IEDFEARIALMPLLQAEKDRRVLQMLRENLEEEATVMKDVPGWKVGESVFHTTRWVTPMM GELYGLRASEEVLSATYGFIWYT

Sequence Length

Full length protein

Application Notes

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Species

Bovine

Preparation and Storage

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for NDUFA13 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

NCBI GI #

28603804

NCBI GeneID

338084

NCBI Accession #

NP_788845.1

NCBI GenBank Nucleotide #

NM_176672.2

UniProt Accession #

Q95KV7; Q3T0G4

Molecular Weight

16,673 Da

NCBI Official Full Name

NADH dehydrogenase

NCBI Official Symbol

NDUFA13

NCBI Official Synonym Symbols

GRIM19

NCBI Protein Information

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

UniProt Protein Name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

Protein Family

NADH dehydrogenase

UniProt Gene Name

NDUFA13

UniProt Synonym Gene Names

GRIM19; CI-B16.6; GRIM-19

UniProt Entry Name

NDUAD_BOVIN

Uniprot Description

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) cell death pathway. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes ().

Similar Products

NDUFA13 Antibody

Host: Rabbit

Reactivity: Human, Mouse, Rat

Apps: Western Blot, Immunohistochemistry

Product Notes

The NDUFA13 ndufa13 (Catalog #AAA7023205) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-144aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the NDUFA13 ndufa13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AASKVKQDMP PVGGYGPIDY KRNLPRRGLS GYSMFAVGIG ALLFGYWSMM KWNRERRRLQ IEDFEARIAL MPLLQAEKDR RVLQMLRENL EEEATVMKDV PGWKVGESVF HTTRWVTPMM GELYGLRASE EVLSATYGFI WYT. It is sometimes possible for the material contained within the vial of "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...