Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Leucine-rich repeat-containing protein 4C (Lrrc4c) Recombinant Protein | Lrrc4c recombinant protein

Recombinant Mouse Leucine-rich repeat-containing protein 4C (Lrrc4c)

Gene Names
Lrrc4c; NGL-1; 6430556C10Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leucine-rich repeat-containing protein 4C (Lrrc4c); Recombinant Mouse Leucine-rich repeat-containing protein 4C (Lrrc4c); Lrrc4c recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
45-640aa; full length protein
Sequence
QTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEI LQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIP SYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDEL DLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPH DLFTPLHHLERIHLHHNPWNCNCDILWLSWWIRDMAPSNTACCARCNTPPNLKGRYIGEL DQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIA VLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEP SQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMK TTKIIIGCFVAITLMAAVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESH LPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Lrrc4c recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71,992 Da
NCBI Official Full Name
leucine-rich repeat-containing protein 4C
NCBI Official Synonym Full Names
leucine rich repeat containing 4C
NCBI Official Symbol
Lrrc4c
NCBI Official Synonym Symbols
NGL-1; 6430556C10Rik
NCBI Protein Information
leucine-rich repeat-containing protein 4C
UniProt Protein Name
Leucine-rich repeat-containing protein 4C
UniProt Gene Name
Lrrc4c
UniProt Synonym Gene Names
Ngl1; NGL-1
UniProt Entry Name
LRC4C_MOUSE

Uniprot Description

LRRC4C: May promote neurite outgrowth of developing thalamic neurons.

Protein type: Cell development/differentiation; Membrane protein, integral

Cellular Component: cell junction; cytoplasm; extracellular space; integral to membrane; membrane; plasma membrane; postsynaptic membrane; synapse

Molecular Function: protein binding; protein kinase inhibitor activity

Biological Process: cytokine and chemokine mediated signaling pathway; negative regulation of JAK-STAT cascade; negative regulation of protein kinase activity; regulation of axonogenesis

Research Articles on Lrrc4c

Similar Products

Product Notes

The Lrrc4c lrrc4c (Catalog #AAA7019166) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 45-640aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Lrrc4c lrrc4c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QTCPSVCSCS NQFSKVICVR KNLREVPDGI STNTRLLNLH ENQIQIIKVN SFKHLRHLEI LQLSRNHIRT IEIGAFNGLA NLNTLELFDN RLTTIPNGAF VYLSKLKELW LRNNPIESIP SYAFNRIPSL RRLDLGELKR LSYISEGAFE GLSNLRYLNL AMCNLREIPN LTPLIKLDEL DLSGNHLSAI RPGSFQGLMH LQKLWMIQSQ IQVIERNAFD NLQSLVEINL AHNNLTLLPH DLFTPLHHLE RIHLHHNPWN CNCDILWLSW WIRDMAPSNT ACCARCNTPP NLKGRYIGEL DQNYFTCYAP VIVEPPADLN VTEGMAAELK CRASTSLTSV SWITPNGTVM THGAYKVRIA VLSDGTLNFT NVTVQDTGMY TCMVSNSVGN TTASATLNVT AATTTPFSYF STVTVETMEP SQDEARTTDN NVGPTPVIDW ETTNVTTSLT PQSTRSTEKT FTIPVTDINS GIPGIDEVMK TTKIIIGCFV AITLMAAVML VIFYKMRKQH HRQNHHAPTR TVEIINVDDE ITGDTPMESH LPMPAIEHEH LNHYNSYKSP FNHTTTVNTI NSIHSSVHEP LLIRMNSKDN VQETQI. It is sometimes possible for the material contained within the vial of "Leucine-rich repeat-containing protein 4C (Lrrc4c), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.