LEM domain-containing protein 2 (LEMD2) Recombinant Protein | LEMD2 recombinant protein
Recombinant Human LEM domain-containing protein 2 (LEMD2)
Gene Names
LEMD2; NET25; dJ482C21.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
LEM domain-containing protein 2 (LEMD2); Recombinant Human LEM domain-containing protein 2 (LEMD2); LEMD2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-503aa; full length protein
Sequence
MAGLSDLELRRELQALGFQPGPITDTTRDVYRNKLRRLRGEARLRDEERLREEARPRGEE RLREEARLREDAPLRARPAAASPRAEPWLSQPASGSAYATPGAYGDIRPSAASWVGSRGL AYPARPAQLRRRASVRGSSEEDEDARTPDRATQGPGLAARRWWAASPAPARLPSSLLGPD PRPGLRATRAGPAGAARARPEVGRRLERWLSRLLLWASLGLLLVFLGILWVKMGKPSAPQ EAEDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCI PVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAH PRMGVGCRLSRALLTAVTNVLIFFWCLAFLWGLLILLKYRWRKLEEEEQAMYEMVKKIID VVQDHYVDWEQDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH RVAGEDMLVWRWTKPSSFSDSER
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for LEMD2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,520 Da
NCBI Official Full Name
LEM domain-containing protein 2 isoform 2
NCBI Official Synonym Full Names
LEM domain containing 2
NCBI Official Symbol
LEMD2
NCBI Official Synonym Symbols
NET25; dJ482C21.1
NCBI Protein Information
LEM domain-containing protein 2
UniProt Protein Name
LEM domain-containing protein 2
Protein Family
UniProt Gene Name
LEMD2
UniProt Synonym Gene Names
hLEM2
UniProt Entry Name
LEMD2_HUMAN
Uniprot Description
LEMD2: Involved in nuclear structure organization.
Protein type: Membrane protein, multi-pass; Nuclear envelope; Membrane protein, integral
Chromosomal Location of Human Ortholog: 6p21.31
Cellular Component: integral to nuclear inner membrane; membrane; nuclear membrane
Biological Process: negative regulation of MAPKKK cascade; negative regulation of protein kinase B signaling cascade; neurogenesis; nuclear membrane organization and biogenesis
Research Articles on LEMD2
Similar Products
Product Notes
The LEMD2 lemd2 (Catalog #AAA7018272) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-503aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the LEMD2 lemd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGLSDLELR RELQALGFQP GPITDTTRDV YRNKLRRLRG EARLRDEERL REEARPRGEE RLREEARLRE DAPLRARPAA ASPRAEPWLS QPASGSAYAT PGAYGDIRPS AASWVGSRGL AYPARPAQLR RRASVRGSSE EDEDARTPDR ATQGPGLAAR RWWAASPAPA RLPSSLLGPD PRPGLRATRA GPAGAARARP EVGRRLERWL SRLLLWASLG LLLVFLGILW VKMGKPSAPQ EAEDNMKLLP VDCERKTDEF CQAKQKAALL ELLHELYNFL AIQAGNFECG NPENLKSKCI PVMEAQEYIA NVTSSSSAKF EAALTWILSS NKDVGIWLKG EDQSELVTTV DKVVCLESAH PRMGVGCRLS RALLTAVTNV LIFFWCLAFL WGLLILLKYR WRKLEEEEQA MYEMVKKIID VVQDHYVDWE QDMERYPYVG ILHVRDSLIP PQSRRRMKRV WDRAVEFLAS NESRIQTESH RVAGEDMLVW RWTKPSSFSD SER. It is sometimes possible for the material contained within the vial of "LEM domain-containing protein 2 (LEMD2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
