3-ketoacyl-CoA synthase 17 (KCS17) Recombinant Protein | KCS17 recombinant protein
Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 17 (KCS17)
Gene Names
KCS2; 3-ketoacyl-CoA synthase 2; F20D22.1; F20D22_1; KCS2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-ketoacyl-CoA synthase 17 (KCS17); Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 17 (KCS17); KCS17 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-528aa; full length protein
Sequence
MNENHIQSDHMNNTIHVTNKKLPNFLLSVRLKYVKLGYHYLISNAVYILILPVGLLAATS SSFSLTDLTLLYNHLLKFHFLSSTLFAALLIFLTTLYFTTRPRRIFLLDFACYKPDSSLI CTRETFMDRSQRVGIFTEDNLAFQQKILERSGLGQKTYFPEALLRVPPNPCMSEARKEAE TVMFGAIDAVLEKTGVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNVLSYNLGGMG CSAGLISIDLAKQLLQVQPNSYALVVSTENITLNWYLGNDRSMLLSNCIFRMGGAAVLLS NRSSDRCRSKYQLIHTVRTHKGSDDNAFNCVYQREDNDDNKQIGVSLSKNLMAIAGEALK TNITTLGPLVLPMSEQLLFFATLVARKVFNVKKIKPYIPDFKLAFEHFCIHAGGRAVLDE IEKNLDLSEWHMEPSRMTLNRFGNTSSSSLWYELAYSEAKGRIKRGDRTWQIAFGSGFKC NSAVWRALRTIDPSKEKKKKTNPWIDEIHEFPVPVPRTSPVTSSSESR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for KCS17 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
59,528 Da
NCBI Official Full Name
3-ketoacyl-CoA synthase 2
NCBI Official Symbol
KCS2
NCBI Official Synonym Symbols
3-ketoacyl-CoA synthase 2; F20D22.1; F20D22_1; KCS2
NCBI Protein Information
3-ketoacyl-CoA synthase 2
UniProt Protein Name
3-ketoacyl-CoA synthase 2
Protein Family
UniProt Gene Name
KCS2
UniProt Synonym Gene Names
VLCFA condensing enzyme 2
UniProt Entry Name
KCS2_ARATH
NCBI Description
Encodes KCS2, a member of the 3-ketoacyl-CoA synthase family involved in the biosynthesis of VLCFA (very long chain fatty acids).
Uniprot Description
Mediates the synthesis of VLCFAs from 22 to 26 carbons in length (e.g. C22, C24, C26) (PubMed:15277688). Involved in the elongation of C20 fatty acid suberin precursors (PubMed:18786002). Functionally redundant with KCS20 in the two-carbon elongation of C22 fatty acids that is required for cuticular wax and root suberin biosynthesis (PubMed:19619160).
Research Articles on KCS17
Similar Products
Product Notes
The KCS17 kcs2 (Catalog #AAA7017821) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-528aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the KCS17 kcs2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNENHIQSDH MNNTIHVTNK KLPNFLLSVR LKYVKLGYHY LISNAVYILI LPVGLLAATS SSFSLTDLTL LYNHLLKFHF LSSTLFAALL IFLTTLYFTT RPRRIFLLDF ACYKPDSSLI CTRETFMDRS QRVGIFTEDN LAFQQKILER SGLGQKTYFP EALLRVPPNP CMSEARKEAE TVMFGAIDAV LEKTGVNPKD IGILVVNCSL FNPTPSLSAM IVNKYKLRGN VLSYNLGGMG CSAGLISIDL AKQLLQVQPN SYALVVSTEN ITLNWYLGND RSMLLSNCIF RMGGAAVLLS NRSSDRCRSK YQLIHTVRTH KGSDDNAFNC VYQREDNDDN KQIGVSLSKN LMAIAGEALK TNITTLGPLV LPMSEQLLFF ATLVARKVFN VKKIKPYIPD FKLAFEHFCI HAGGRAVLDE IEKNLDLSEW HMEPSRMTLN RFGNTSSSSL WYELAYSEAK GRIKRGDRTW QIAFGSGFKC NSAVWRALRT IDPSKEKKKK TNPWIDEIHE FPVPVPRTSP VTSSSESR. It is sometimes possible for the material contained within the vial of "3-ketoacyl-CoA synthase 17 (KCS17), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
