Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2) Recombinant Protein | Hsd3b2 recombinant protein

Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2); Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2); Hsd3b2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-373aa; Full length protein
Sequence
PGWSCLVTGAGGFLGQRIIQLLVQEEDLEEIRVLDKVFRPETRKEFFNLETSIKVTVLEG DILDTQYLRRACQGISVVIHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFI FSSSVDVAGPNSYKEIVLNGHEEECHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQ TCALRPMCIYGERSPLISNIIIMALKHKGILRSFGKFNTANPVYVGNVAWAHILAARGLR DPKKSPNIQGEFYYISDDTPHQSFDDISYTLSKEWGFCLDSSWSLPVPLLYWLAFLLETV SFLLSPIYRYIPPFNRHLVTLSGSTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV EQHRETLDTKSQ
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Hsd3b2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,923 Da
NCBI Official Full Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
NCBI Official Synonym Full Names
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
NCBI Official Symbol
Hsd3b2
NCBI Protein Information
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
UniProt Protein Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
UniProt Gene Name
Hsd3b2
UniProt Synonym Gene Names
3-beta-HSD II
UniProt Entry Name
3BHS2_MOUSE

Uniprot Description

HSD3B2: protein localized to the nucleus in proliferating cells that seems to possess a tumor suppressor activity. Directly interacts with the RNA helicase eIF4A and inhibits protein synthesis by interfering with the assembly of the cap-dependent translation initiation complex. Suppresses carbonic anhydrase type II protein expression in carcinoid cell lines. Since tumor cells require a high bicarbonate flux for their growth, carbonic anhydrase suppression results in growth inhibition. Expression of this gene is modulated by cytokines in natural killer and T cells. The gene product is thought to play a role in apoptosis but the specific role has not yet been determined. Two differentially spliced isoforms have been identified.

Protein type: Membrane protein, integral; Lipid Metabolism - C21-steroid hormone; Oxidoreductase; Isomerase; Mitochondrial; Lipid Metabolism - androgen and estrogen; Endoplasmic reticulum; EC 1.1.1.145; EC 5.3.3.1

Cellular Component: endoplasmic reticulum; integral to membrane; membrane; mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrion

Molecular Function: 3-beta-hydroxy-delta5-steroid dehydrogenase activity; catalytic activity; isomerase activity; oxidoreductase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor; steroid delta-isomerase activity

Biological Process: metabolic process; steroid biosynthetic process

Research Articles on Hsd3b2

Similar Products

Product Notes

The Hsd3b2 hsd3b2 (Catalog #AAA7016799) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-373aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Hsd3b2 hsd3b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PGWSCLVTGA GGFLGQRIIQ LLVQEEDLEE IRVLDKVFRP ETRKEFFNLE TSIKVTVLEG DILDTQYLRR ACQGISVVIH TAAIIDVTGV IPRQTILDVN LKGTQNLLEA CIQASVPAFI FSSSVDVAGP NSYKEIVLNG HEEECHESTW SDPYPYSKKM AEKAVLAANG SMLKNGGTLQ TCALRPMCIY GERSPLISNI IIMALKHKGI LRSFGKFNTA NPVYVGNVAW AHILAARGLR DPKKSPNIQG EFYYISDDTP HQSFDDISYT LSKEWGFCLD SSWSLPVPLL YWLAFLLETV SFLLSPIYRY IPPFNRHLVT LSGSTFTFSY KKAQRDLGYE PLVSWEEAKQ KTSEWIGTLV EQHRETLDTK SQ. It is sometimes possible for the material contained within the vial of "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.