Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

HERV-H LTR-associating protein 2 (HHLA2) Recombinant Protein | HHLA2 recombinant protein

Recombinant Human HERV-H LTR-associating protein 2 (HHLA2)

Gene Names
HHLA2; B7y; B7H7; B7-H5; B7-H7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HERV-H LTR-associating protein 2 (HHLA2); Recombinant Human HERV-H LTR-associating protein 2 (HHLA2); HHLA2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-414aa; full length protein
Sequence
IFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLE SQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFL TPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNIT GSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSR MKSGTFSVLAYYLSSSQNTIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSD EYTLLTIHTVHVEPSQETASHNKGLWILVPSAILAAFLLIWSVKCCRAQLEARRSRHPAD GAQQERCCVPPGERCPSAPDNGEENVPLSGKV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for HHLA2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,614 Da
NCBI Official Full Name
HERV-H LTR-associating protein 2 isoform a
NCBI Official Synonym Full Names
HERV-H LTR-associating 2
NCBI Official Symbol
HHLA2
NCBI Official Synonym Symbols
B7y; B7H7; B7-H5; B7-H7
NCBI Protein Information
HERV-H LTR-associating protein 2
UniProt Protein Name
HERV-H LTR-associating protein 2
UniProt Gene Name
HHLA2
UniProt Entry Name
HHLA2_HUMAN

NCBI Description

This gene encodes a protein ligand found on the surface of monocytes. The encoded protein is thought to regulate cell-mediated immunity by binding to a receptor on T lymphocytes and inhibiting the proliferation of these cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

HHLA2: Through interaction with TMIGD2, costimulates T-cells in the context of TCR-mediated activation. Enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade. Up-regulated in antigen-presenting cells in response to inflammation. Induced in dendritic cells in response to IFNG, poly(I:C) or heat-killed Listeria monocytogenes (at protein level). Interacts with TMIGD2. 2 isoforms of the human protein are produced by alternative splicing

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q13.13

Cellular Component: integral to membrane

Molecular Function: protein binding

Biological Process: positive regulation of activated T cell proliferation; positive regulation of cytokine production; T cell costimulation

Research Articles on HHLA2

Similar Products

Product Notes

The HHLA2 hhla2 (Catalog #AAA7016602) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-414aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the HHLA2 hhla2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IFPLAFFIYV PMNEQIVIGR LDEDIILPSS FERGSEVVIH WKYQDSYKVH SYYKGSDHLE SQDPRYANRT SLFYNEIQNG NASLFFRRVS LLDEGIYTCY VGTAIQVITN KVVLKVGVFL TPVMKYEKRN TNSFLICSVL SVYPRPIITW KMDNTPISEN NMEETGSLDS FSINSPLNIT GSNSSYECTI ENSLLKQTWT GRWTMKDGLH KMQSEHVSLS CQPVNDYFSP NQDFKVTWSR MKSGTFSVLA YYLSSSQNTI INESRFSWNK ELINQSDFSM NLMDLNLSDS GEYLCNISSD EYTLLTIHTV HVEPSQETAS HNKGLWILVP SAILAAFLLI WSVKCCRAQL EARRSRHPAD GAQQERCCVP PGERCPSAPD NGEENVPLSG KV. It is sometimes possible for the material contained within the vial of "HERV-H LTR-associating protein 2 (HHLA2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.