Probable G-protein coupled receptor 111 (GPR111) Recombinant Protein | GPR111 recombinant protein
Recombinant Human Probable G-protein coupled receptor 111 (GPR111)
Gene Names
ADGRF2; PGR20; GPR111; hGPCR35
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable G-protein coupled receptor 111 (GPR111); Recombinant Human Probable G-protein coupled receptor 111 (GPR111); GPR111 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-708aa; full length protein
Sequence
MGLTAYGNRRVQPGELPFGANLTLIHTRAQPVICSKLLLTKRVSPISFFLSKFQNSWGED GWVQLDQLPSPNAVSSDQVHCSAGCTHRKCGWAASKSKEKVPARPHGVCDGVCTDYSQCT QPCPPDTQGNMGFSCRQKTWHKITDTCQTLNALNIFEEDSRLVQPFEDNIKISVYTGKSE TITDMLLQKCPTDLSCVIRNIQQSPWIPGNIAVIVQLLHNISTAIWTGVDEAKMQSYSTI ANHILNSKSISNWTFIPDRNSSYILLHSVNSFARRLFIDKHPVDISDVFIHTMGTTISGD NIGKNFTFSMRINDTSNEVTGRVLISRDELRKVPSPSQVISIAFPTIGAILEASLLENVT VNGLVLSAILPKELKRISLIFEKISKSEERRTQCVGWHSVENRWDQQACKMIQENSQQAV CKCRPSKLFTSFSILMSPHILESLILTYITYVGLGISICSLILCLSIEVLVWSQVTKTEI TYLRHVCIVNIAATLLMADVWFIVASFLSGPITHHKGCVAATFFVHFFYLSVFFWMLAKA LLILYGIMIVFHTLPKSVLVASLFSVGYGCPLAIAAITVAATEPGKGYLRPEICWLNWDM TKALLAFVIPALAIVVVNLITVTLVIVKTQRAAIGNSMFQEVRAIVRISKNIAILTPLLG LTWGFGVATVIDDRSLAFHIIFSLLNAFQVSPDASDQVQSERIHEDVL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GPR111 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
71,555 Da
NCBI Official Full Name
adhesion G-protein coupled receptor F2
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor F2
NCBI Official Symbol
ADGRF2
NCBI Official Synonym Symbols
PGR20; GPR111; hGPCR35
NCBI Protein Information
adhesion G-protein coupled receptor F2
UniProt Protein Name
Adhesion G-protein coupled receptor F2
UniProt Gene Name
ADGRF2
UniProt Synonym Gene Names
GPR111; PGR20
UniProt Entry Name
AGRF2_HUMAN
Uniprot Description
GPR111: Orphan receptor. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 2
Chromosomal Location of Human Ortholog: 6p12.3
Cellular Component: integral to membrane
Molecular Function: G-protein coupled receptor activity
Biological Process: cell surface receptor linked signal transduction; G-protein coupled receptor protein signaling pathway
Similar Products
Product Notes
The GPR111 adgrf2 (Catalog #AAA7016063) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-708aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GPR111 adgrf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGLTAYGNRR VQPGELPFGA NLTLIHTRAQ PVICSKLLLT KRVSPISFFL SKFQNSWGED GWVQLDQLPS PNAVSSDQVH CSAGCTHRKC GWAASKSKEK VPARPHGVCD GVCTDYSQCT QPCPPDTQGN MGFSCRQKTW HKITDTCQTL NALNIFEEDS RLVQPFEDNI KISVYTGKSE TITDMLLQKC PTDLSCVIRN IQQSPWIPGN IAVIVQLLHN ISTAIWTGVD EAKMQSYSTI ANHILNSKSI SNWTFIPDRN SSYILLHSVN SFARRLFIDK HPVDISDVFI HTMGTTISGD NIGKNFTFSM RINDTSNEVT GRVLISRDEL RKVPSPSQVI SIAFPTIGAI LEASLLENVT VNGLVLSAIL PKELKRISLI FEKISKSEER RTQCVGWHSV ENRWDQQACK MIQENSQQAV CKCRPSKLFT SFSILMSPHI LESLILTYIT YVGLGISICS LILCLSIEVL VWSQVTKTEI TYLRHVCIVN IAATLLMADV WFIVASFLSG PITHHKGCVA ATFFVHFFYL SVFFWMLAKA LLILYGIMIV FHTLPKSVLV ASLFSVGYGC PLAIAAITVA ATEPGKGYLR PEICWLNWDM TKALLAFVIP ALAIVVVNLI TVTLVIVKTQ RAAIGNSMFQ EVRAIVRISK NIAILTPLLG LTWGFGVATV IDDRSLAFHI IFSLLNAFQV SPDASDQVQS ERIHEDVL. It is sometimes possible for the material contained within the vial of "Probable G-protein coupled receptor 111 (GPR111), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
