Envelope glycoprotein (GP) Recombinant Protein | GP recombinant protein
Recombinant Uukuniemi virus Envelope glycoprotein (GP)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Envelope glycoprotein (GP); Recombinant Uukuniemi virus Envelope glycoprotein (GP); GP recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
514-1008aa; full length protein
Sequence
CSDSISVTASSQRCSTSSDGVNSCFVSTSSLLQVSPKGQESCLILKGPTGTAVDSIRIKT TDIKLECVRRDLYWVPRVTHRCIGTRRCHLMGACKGEACSEFKINDYSPEWGHEEELMAQ LGWSYCVEQCGGALCQCFNMRPSCFYLRKTFSHLSQDAFNIYECSEWSYRINVLVSTNST HSNLTLKLGVPDSIPHGLISLSSVSQPPAIAYSECFGEDLHGTKFHTVCNRRTDYTLGRI GEIQCPTKADALAVSKRCISSDSIIFSKVHKDSVDCQSSIIDPMTIRNRNKLPSTVGSVT FWPTETSVEAAIPDLASATMLIRLDGYTIQFRSDSNKCSPRFLSLSGCYNCEAGAKLELE HVTDFGTALGILECPSLGYTTYYEVKNTLEKSIRTMHLNGSHVEAKCYFRCPNSESQLTI RGELIYLFNDDIRHHNQTLSPGLSPKSGSGWDPFGWFKASWLRAIWAILGGTVSLIIGVV IIYMVFTLCLKVKKS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Uukuniemi virus (strain S23) (Uuk)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GP recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
113,589 Da
NCBI Official Full Name
membrane glycoprotein polyprotein
NCBI Official Symbol
UUKVsMgp1
NCBI Protein Information
membrane glycoprotein polyprotein; membrane glycoprotein G1; membrane glycoprotein G2
UniProt Protein Name
Envelopment polyprotein
Protein Family
UniProt Gene Name
GP
UniProt Synonym Gene Names
Gc
UniProt Entry Name
GP_UUKS
Uniprot Description
Glycoprotein N and Glycoprotein C interact with each other and are present at the surface of the virion. They are able to attach the virion to a cell receptor and to promote fusion of membranes after endocytosis of the virion ().
Similar Products
Product Notes
The GP gp (Catalog #AAA7015965) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 514-1008aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GP gp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CSDSISVTAS SQRCSTSSDG VNSCFVSTSS LLQVSPKGQE SCLILKGPTG TAVDSIRIKT TDIKLECVRR DLYWVPRVTH RCIGTRRCHL MGACKGEACS EFKINDYSPE WGHEEELMAQ LGWSYCVEQC GGALCQCFNM RPSCFYLRKT FSHLSQDAFN IYECSEWSYR INVLVSTNST HSNLTLKLGV PDSIPHGLIS LSSVSQPPAI AYSECFGEDL HGTKFHTVCN RRTDYTLGRI GEIQCPTKAD ALAVSKRCIS SDSIIFSKVH KDSVDCQSSI IDPMTIRNRN KLPSTVGSVT FWPTETSVEA AIPDLASATM LIRLDGYTIQ FRSDSNKCSP RFLSLSGCYN CEAGAKLELE HVTDFGTALG ILECPSLGYT TYYEVKNTLE KSIRTMHLNG SHVEAKCYFR CPNSESQLTI RGELIYLFND DIRHHNQTLS PGLSPKSGSG WDPFGWFKAS WLRAIWAILG GTVSLIIGVV IIYMVFTLCL KVKKS. It is sometimes possible for the material contained within the vial of "Envelope glycoprotein (GP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
