Envelope glycoprotein (GP) Recombinant Protein | GP recombinant protein
Recombinant Hantaan virus Envelope glycoprotein (GP)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Envelope glycoprotein (GP); Recombinant Hantaan virus Envelope glycoprotein (GP); GP recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
649-1134aa; Partial(Glycoprotein C Chain)
Sequence
SETPLTPVWNDNAHGVGSIPMHTDLELDFSLTSSSKYTYRRKLTNPLEAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPSDCPGCGTGCTACGLYLDRLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWRTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFKCCHGEDCSPNGLHAAAPHLDKVNGISEIENSKEYDDGAPQCGIKCWFVKSGEWISGIFSGNWIVLIVLCVFLLFSLVLLSILCPVRKHKKS
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Hantaan virus (strain Hojo) (Hojo virus) (Korean hemorrhagic fever virus)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GP recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
126,405 Da
NCBI Official Full Name
Envelopment polyprotein
UniProt Protein Name
Envelopment polyprotein
Protein Family
UniProt Gene Name
GP
UniProt Synonym Gene Names
Gc
UniProt Entry Name
GP_HANTH
Uniprot Description
Glycoprotein N and Glycoprotein C interact with each other and are present at the surface of the virion. They are able to attach the virion to host cell receptors. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Also promote fusion of viral membrane with host endosomal membrane after endocytosis of the virion. Glycoprotein N contains an ITAM motif which is likely to dysregulate normal immune and endothelial cell responses and contribute to virus pathogenesis ().
Similar Products
Product Notes
The GP gp (Catalog #AAA7015946) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 649-1134aa; Partial(Glycoprotein C Chain). This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GP gp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SETPLTPVWN DNAHGVGSIP MHTDLELDFS LTSSSKYTYR RKLTNPLEAQ SIDLHIEIEE QTIGVDVHAL GHWFDGRLNL KTSFHCYGAC TKYEYPWHTA KCHYERDYQY ETSWGCNPSD CPGCGTGCTA CGLYLDRLKP VGSAYKIITI RYSRRVCVQF GEENLCKIID MNDCFVSRHV KVCIIGTVSK FSQGDTLLFF GPLEGGGLIF KHWRTSTCQF GDPGDIMSPR DKGFLCPEFP GSFRKKCNFA TTPICEYDGN MVSGYKKVMA TIDSFQSFNT STMHFTDERI EWKDPDGMLR DHINILVTKD IDFDNLGENP CKIGLQTSSI EGAWGSGVGF TLTCLVSLTE CPTFLTSIKA CDKAICYGAE SVTLTRGQNT VKVSGKGGHS GSTFKCCHGE DCSPNGLHAA APHLDKVNGI SEIENSKEYD DGAPQCGIKC WFVKSGEWIS GIFSGNWIVL IVLCVFLLFS LVLLSILCPV RKHKKS . It is sometimes possible for the material contained within the vial of "Envelope glycoprotein (GP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
