GTPase IMAP family member 2 (GIMAP2) Recombinant Protein | GIMAP2 recombinant protein
Recombinant Human GTPase IMAP family member 2 (GIMAP2)
Gene Names
GIMAP2; IAN12; IMAP2; HIMAP2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GTPase IMAP family member 2 (GIMAP2); Recombinant Human GTPase IMAP family member 2 (GIMAP2); GIMAP2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-337aa; full length protein
Sequence
MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKT CSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTS QDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRIC AFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFK QSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLFLRLIILWLCILHSMCNLFCC LLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GIMAP2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,017 Da
NCBI Official Full Name
GTPase IMAP family member 2
NCBI Official Synonym Full Names
GTPase, IMAP family member 2
NCBI Official Symbol
GIMAP2
NCBI Official Synonym Symbols
IAN12; IMAP2; HIMAP2
NCBI Protein Information
GTPase IMAP family member 2
UniProt Protein Name
GTPase IMAP family member 2
Protein Family
UniProt Gene Name
GIMAP2
UniProt Synonym Gene Names
IMAP2; hIMAP2
UniProt Entry Name
GIMA2_HUMAN
NCBI Description
This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq, Jul 2008]
Uniprot Description
GIMAP2: a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq, Jul 2008]
Protein type: Membrane protein, integral; Membrane protein, multi-pass; Hydrolase
Chromosomal Location of Human Ortholog: 7q36.1
Cellular Component: cytoplasm; integral to membrane; lipid particle
Molecular Function: GTP binding
Research Articles on GIMAP2
Similar Products
Product Notes
The GIMAP2 gimap2 (Catalog #AAA7015657) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-337aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GIMAP2 gimap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDQNEHSHWG PHAKGQCASR SELRIILVGK TGTGKSAAGN SILRKQAFES KLGSQTLTKT CSKSQGSWGN REIVIIDTPD MFSWKDHCEA LYKEVQRCYL LSAPGPHVLL LVTQLGRYTS QDQQAAQRVK EIFGEDAMGH TIVLFTHKED LNGGSLMDYM HDSDNKALSK LVAACGGRIC AFNNRAEGSN QDDQVKELMD CIEDLLMEKN GDHYTNGLYS LIQRSKCGPV GSDERVKEFK QSLIKYMETQ RSYTALAEAN CLKGALIKTQ LCVLFCIQLF LRLIILWLCI LHSMCNLFCC LLFSMCNLFC SLLFIIPKKL MIFLRTVIRL ERKTPRL. It is sometimes possible for the material contained within the vial of "GTPase IMAP family member 2 (GIMAP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
